Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 4876250..4877049 | Replicon | chromosome |
| Accession | NZ_CP101302 | ||
| Organism | Escherichia coli strain 2000-3039 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | U9XVR9 |
| Locus tag | NMK59_RS24560 | Protein ID | WP_000347267.1 |
| Coordinates | 4876585..4877049 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | NMK59_RS24555 | Protein ID | WP_001307405.1 |
| Coordinates | 4876250..4876585 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK59_RS24540 (4872035) | 4872035..4872805 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| NMK59_RS24545 (4872821) | 4872821..4874155 | - | 1335 | WP_000599627.1 | galactarate/glucarate/glycerate transporter GarP | - |
| NMK59_RS24550 (4874530) | 4874530..4876101 | + | 1572 | WP_001273741.1 | galactarate dehydratase | - |
| NMK59_RS24555 (4876250) | 4876250..4876585 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NMK59_RS24560 (4876585) | 4876585..4877049 | + | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NMK59_RS24565 (4877104) | 4877104..4877913 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| NMK59_RS24570 (4878162) | 4878162..4879442 | + | 1281 | WP_000681952.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NMK59_RS24575 (4879465) | 4879465..4879938 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NMK59_RS24580 (4879949) | 4879949..4880728 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NMK59_RS24585 (4880718) | 4880718..4881596 | + | 879 | WP_001399813.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NMK59_RS24590 (4881614) | 4881614..4882048 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4864202..4877049 | 12847 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T251851 WP_000347267.1 NZ_CP101302:4876585-4877049 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XTR4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |