Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 2582311..2582682 | Replicon | chromosome |
| Accession | NZ_CP101302 | ||
| Organism | Escherichia coli strain 2000-3039 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | F4VC37 |
| Locus tag | NMK59_RS12895 | Protein ID | WP_001317028.1 |
| Coordinates | 2582488..2582682 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 2582311..2582489 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK59_RS12865 (2578063) | 2578063..2578236 | + | 174 | WP_001296046.1 | protein YnaL | - |
| NMK59_RS12870 (2578266) | 2578266..2579639 | + | 1374 | WP_000123745.1 | ATP-dependent RNA helicase DbpA | - |
| NMK59_RS12875 (2579768) | 2579768..2580703 | - | 936 | WP_023982888.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| NMK59_RS12880 (2580755) | 2580755..2581990 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
| NMK59_RS12885 (2581992) | 2581992..2582207 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (2582311) | 2582311..2582489 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2582311) | 2582311..2582489 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2582311) | 2582311..2582489 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2582311) | 2582311..2582489 | + | 179 | NuclAT_0 | - | Antitoxin |
| NMK59_RS12890 (2582286) | 2582286..2582495 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
| NMK59_RS12895 (2582488) | 2582488..2582682 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| NMK59_RS12900 (2582739) | 2582739..2583548 | - | 810 | WP_000595430.1 | recombination protein RecT | - |
| NMK59_RS12905 (2583541) | 2583541..2586186 | - | 2646 | WP_000105154.1 | exodeoxyribonuclease VIII | - |
| NMK59_RS12910 (2586288) | 2586288..2586563 | - | 276 | WP_000632297.1 | protein RacC | - |
| NMK59_RS12915 (2586638) | 2586638..2586808 | - | 171 | WP_001359121.1 | YdaE family protein | - |
| NMK59_RS12920 (2586808) | 2586808..2587029 | - | 222 | WP_000560227.1 | cell division protein FtsZ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2580755..2627886 | 47131 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T251837 WP_001317028.1 NZ_CP101302:c2582682-2582488 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT251837 NZ_CP101302:2582311-2582489 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
