Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2358265..2358485 Replicon chromosome
Accession NZ_CP101302
Organism Escherichia coli strain 2000-3039

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag NMK59_RS11585 Protein ID WP_000170965.1
Coordinates 2358265..2358372 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2358419..2358485 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMK59_RS11555 2354120..2354953 + 834 WP_000456459.1 peptide chain release factor N(5)-glutamine methyltransferase -
NMK59_RS11560 2354950..2355342 + 393 WP_000200392.1 invasion regulator SirB2 -
NMK59_RS11565 2355346..2356155 + 810 WP_001257044.1 invasion regulator SirB1 -
NMK59_RS11570 2356191..2357045 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
NMK59_RS11575 2357194..2357301 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2357349..2357415 + 67 NuclAT_40 - -
- 2357349..2357415 + 67 NuclAT_40 - -
- 2357349..2357415 + 67 NuclAT_40 - -
- 2357349..2357415 + 67 NuclAT_40 - -
- 2357349..2357415 + 67 NuclAT_43 - -
- 2357349..2357415 + 67 NuclAT_43 - -
- 2357349..2357415 + 67 NuclAT_43 - -
- 2357349..2357415 + 67 NuclAT_43 - -
- 2357351..2357414 + 64 NuclAT_17 - -
- 2357351..2357414 + 64 NuclAT_17 - -
- 2357351..2357414 + 64 NuclAT_17 - -
- 2357351..2357414 + 64 NuclAT_17 - -
- 2357351..2357414 + 64 NuclAT_20 - -
- 2357351..2357414 + 64 NuclAT_20 - -
- 2357351..2357414 + 64 NuclAT_20 - -
- 2357351..2357414 + 64 NuclAT_20 - -
- 2357351..2357414 + 64 NuclAT_23 - -
- 2357351..2357414 + 64 NuclAT_23 - -
- 2357351..2357414 + 64 NuclAT_23 - -
- 2357351..2357414 + 64 NuclAT_23 - -
- 2357351..2357414 + 64 NuclAT_26 - -
- 2357351..2357414 + 64 NuclAT_26 - -
- 2357351..2357414 + 64 NuclAT_26 - -
- 2357351..2357414 + 64 NuclAT_26 - -
- 2357351..2357414 + 64 NuclAT_29 - -
- 2357351..2357414 + 64 NuclAT_29 - -
- 2357351..2357414 + 64 NuclAT_29 - -
- 2357351..2357414 + 64 NuclAT_29 - -
- 2357351..2357414 + 64 NuclAT_32 - -
- 2357351..2357414 + 64 NuclAT_32 - -
- 2357351..2357414 + 64 NuclAT_32 - -
- 2357351..2357414 + 64 NuclAT_32 - -
NMK59_RS11580 2357729..2357836 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2357889..2357950 + 62 NuclAT_18 - -
- 2357889..2357950 + 62 NuclAT_18 - -
- 2357889..2357950 + 62 NuclAT_18 - -
- 2357889..2357950 + 62 NuclAT_18 - -
- 2357889..2357950 + 62 NuclAT_21 - -
- 2357889..2357950 + 62 NuclAT_21 - -
- 2357889..2357950 + 62 NuclAT_21 - -
- 2357889..2357950 + 62 NuclAT_21 - -
- 2357889..2357950 + 62 NuclAT_24 - -
- 2357889..2357950 + 62 NuclAT_24 - -
- 2357889..2357950 + 62 NuclAT_24 - -
- 2357889..2357950 + 62 NuclAT_24 - -
- 2357889..2357950 + 62 NuclAT_27 - -
- 2357889..2357950 + 62 NuclAT_27 - -
- 2357889..2357950 + 62 NuclAT_27 - -
- 2357889..2357950 + 62 NuclAT_27 - -
- 2357889..2357950 + 62 NuclAT_30 - -
- 2357889..2357950 + 62 NuclAT_30 - -
- 2357889..2357950 + 62 NuclAT_30 - -
- 2357889..2357950 + 62 NuclAT_30 - -
- 2357889..2357950 + 62 NuclAT_33 - -
- 2357889..2357950 + 62 NuclAT_33 - -
- 2357889..2357950 + 62 NuclAT_33 - -
- 2357889..2357950 + 62 NuclAT_33 - -
- 2357889..2357951 + 63 NuclAT_42 - -
- 2357889..2357951 + 63 NuclAT_42 - -
- 2357889..2357951 + 63 NuclAT_42 - -
- 2357889..2357951 + 63 NuclAT_42 - -
- 2357889..2357951 + 63 NuclAT_45 - -
- 2357889..2357951 + 63 NuclAT_45 - -
- 2357889..2357951 + 63 NuclAT_45 - -
- 2357889..2357951 + 63 NuclAT_45 - -
NMK59_RS11585 2358265..2358372 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2358419..2358485 + 67 - - Antitoxin
NMK59_RS11590 2358777..2359877 - 1101 WP_023982899.1 sodium-potassium/proton antiporter ChaA -
NMK59_RS11595 2360147..2360377 + 231 WP_001146442.1 putative cation transport regulator ChaB -
NMK59_RS11600 2360535..2361230 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
NMK59_RS11605 2361274..2361627 - 354 WP_001169666.1 DsrE/F sulfur relay family protein YchN -
NMK59_RS11610 2361812..2363206 + 1395 WP_000086212.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T251836 WP_000170965.1 NZ_CP101302:c2358372-2358265 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT251836 NZ_CP101302:2358419-2358485 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References