Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2357729..2357950 | Replicon | chromosome |
| Accession | NZ_CP101302 | ||
| Organism | Escherichia coli strain 2000-3039 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | E0IV43 |
| Locus tag | NMK59_RS11580 | Protein ID | WP_000170926.1 |
| Coordinates | 2357729..2357836 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2357889..2357950 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK59_RS11550 (2353038) | 2353038..2354120 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| NMK59_RS11555 (2354120) | 2354120..2354953 | + | 834 | WP_000456459.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| NMK59_RS11560 (2354950) | 2354950..2355342 | + | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
| NMK59_RS11565 (2355346) | 2355346..2356155 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| NMK59_RS11570 (2356191) | 2356191..2357045 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| NMK59_RS11575 (2357194) | 2357194..2357301 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_17 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_17 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_17 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_17 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_20 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_20 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_20 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_20 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_23 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_23 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_23 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_23 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_26 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_26 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_26 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_26 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_29 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_29 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_29 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_29 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_32 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_32 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_32 | - | - |
| - (2357351) | 2357351..2357414 | + | 64 | NuclAT_32 | - | - |
| - (2357349) | 2357349..2357415 | + | 67 | NuclAT_40 | - | - |
| - (2357349) | 2357349..2357415 | + | 67 | NuclAT_40 | - | - |
| - (2357349) | 2357349..2357415 | + | 67 | NuclAT_40 | - | - |
| - (2357349) | 2357349..2357415 | + | 67 | NuclAT_40 | - | - |
| - (2357349) | 2357349..2357415 | + | 67 | NuclAT_43 | - | - |
| - (2357349) | 2357349..2357415 | + | 67 | NuclAT_43 | - | - |
| - (2357349) | 2357349..2357415 | + | 67 | NuclAT_43 | - | - |
| - (2357349) | 2357349..2357415 | + | 67 | NuclAT_43 | - | - |
| NMK59_RS11580 (2357729) | 2357729..2357836 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_18 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_18 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_18 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_18 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_21 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_21 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_21 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_21 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_24 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_24 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_24 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_24 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_27 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_27 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_27 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_27 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_30 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_30 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_30 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_30 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_33 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_33 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_33 | - | Antitoxin |
| - (2357889) | 2357889..2357950 | + | 62 | NuclAT_33 | - | Antitoxin |
| - (2357889) | 2357889..2357951 | + | 63 | NuclAT_42 | - | - |
| - (2357889) | 2357889..2357951 | + | 63 | NuclAT_42 | - | - |
| - (2357889) | 2357889..2357951 | + | 63 | NuclAT_42 | - | - |
| - (2357889) | 2357889..2357951 | + | 63 | NuclAT_42 | - | - |
| - (2357889) | 2357889..2357951 | + | 63 | NuclAT_45 | - | - |
| - (2357889) | 2357889..2357951 | + | 63 | NuclAT_45 | - | - |
| - (2357889) | 2357889..2357951 | + | 63 | NuclAT_45 | - | - |
| - (2357889) | 2357889..2357951 | + | 63 | NuclAT_45 | - | - |
| NMK59_RS11585 (2358265) | 2358265..2358372 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_16 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_16 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_16 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_16 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_19 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_19 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_19 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_19 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_22 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_22 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_22 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_22 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_25 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_25 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_25 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_25 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_28 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_28 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_28 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_28 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_31 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_31 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_31 | - | - |
| - (2358420) | 2358420..2358485 | + | 66 | NuclAT_31 | - | - |
| - (2358421) | 2358421..2358486 | + | 66 | NuclAT_41 | - | - |
| - (2358421) | 2358421..2358486 | + | 66 | NuclAT_41 | - | - |
| - (2358421) | 2358421..2358486 | + | 66 | NuclAT_41 | - | - |
| - (2358421) | 2358421..2358486 | + | 66 | NuclAT_41 | - | - |
| - (2358421) | 2358421..2358486 | + | 66 | NuclAT_44 | - | - |
| - (2358421) | 2358421..2358486 | + | 66 | NuclAT_44 | - | - |
| - (2358421) | 2358421..2358486 | + | 66 | NuclAT_44 | - | - |
| - (2358421) | 2358421..2358486 | + | 66 | NuclAT_44 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_34 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_34 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_34 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_34 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_35 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_35 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_35 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_35 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_36 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_36 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_36 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_36 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_37 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_37 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_37 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_37 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_38 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_38 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_38 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_38 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_39 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_39 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_39 | - | - |
| - (2358420) | 2358420..2358487 | + | 68 | NuclAT_39 | - | - |
| NMK59_RS11590 (2358777) | 2358777..2359877 | - | 1101 | WP_023982899.1 | sodium-potassium/proton antiporter ChaA | - |
| NMK59_RS11595 (2360147) | 2360147..2360377 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| NMK59_RS11600 (2360535) | 2360535..2361230 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| NMK59_RS11605 (2361274) | 2361274..2361627 | - | 354 | WP_001169666.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.84 Da Isoelectric Point: 11.6501
>T251832 WP_000170926.1 NZ_CP101302:c2357836-2357729 [Escherichia coli]
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 62 bp
>AT251832 NZ_CP101302:2357889-2357950 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
