Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 5635095..5635697 | Replicon | chromosome |
| Accession | NZ_CP101292 | ||
| Organism | Escherichia coli strain 2003-3014 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | NMK58_RS28945 | Protein ID | WP_000897305.1 |
| Coordinates | 5635386..5635697 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NMK58_RS28940 | Protein ID | WP_000356397.1 |
| Coordinates | 5635095..5635385 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK58_RS28915 (5630641) | 5630641..5631276 | + | 636 | WP_000829008.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NMK58_RS28920 (5631273) | 5631273..5632202 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| NMK58_RS28925 (5632602) | 5632602..5633582 | + | 981 | WP_000399648.1 | IS110-like element IS621 family transposase | - |
| NMK58_RS28930 (5633811) | 5633811..5634053 | - | 243 | WP_001086390.1 | protein YiiF | - |
| NMK58_RS28935 (5634272) | 5634272..5634490 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| NMK58_RS28940 (5635095) | 5635095..5635385 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| NMK58_RS28945 (5635386) | 5635386..5635697 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| NMK58_RS28950 (5635926) | 5635926..5636834 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| NMK58_RS28955 (5636898) | 5636898..5637839 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| NMK58_RS28960 (5637884) | 5637884..5638321 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| NMK58_RS28965 (5638318) | 5638318..5639190 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| NMK58_RS28970 (5639184) | 5639184..5639783 | - | 600 | WP_001315111.1 | glucose-1-phosphatase | - |
| NMK58_RS28975 (5639882) | 5639882..5640667 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 5632602..5633582 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T251822 WP_000897305.1 NZ_CP101292:c5635697-5635386 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|