Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 5140058..5140857 | Replicon | chromosome |
| Accession | NZ_CP101292 | ||
| Organism | Escherichia coli strain 2003-3014 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | NMK58_RS26535 | Protein ID | WP_000347273.1 |
| Coordinates | 5140393..5140857 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | NMK58_RS26530 | Protein ID | WP_001307405.1 |
| Coordinates | 5140058..5140393 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK58_RS26515 (5135843) | 5135843..5136613 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| NMK58_RS26520 (5136629) | 5136629..5137963 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| NMK58_RS26525 (5138338) | 5138338..5139909 | + | 1572 | WP_001273779.1 | galactarate dehydratase | - |
| NMK58_RS26530 (5140058) | 5140058..5140393 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NMK58_RS26535 (5140393) | 5140393..5140857 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NMK58_RS26540 (5140912) | 5140912..5141721 | - | 810 | WP_000072193.1 | aga operon transcriptional regulator AgaR | - |
| NMK58_RS26545 (5141970) | 5141970..5143250 | + | 1281 | WP_000681914.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NMK58_RS26550 (5143273) | 5143273..5143746 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NMK58_RS26555 (5143757) | 5143757..5144536 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NMK58_RS26560 (5144526) | 5144526..5145404 | + | 879 | WP_001341890.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NMK58_RS26565 (5145422) | 5145422..5145856 | + | 435 | WP_000948822.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 5129402..5140857 | 11455 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T251821 WP_000347273.1 NZ_CP101292:5140393-5140857 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SSH7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |