Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4642865..4643592 | Replicon | chromosome |
| Accession | NZ_CP101292 | ||
| Organism | Escherichia coli strain 2003-3014 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | I2UEW4 |
| Locus tag | NMK58_RS24125 | Protein ID | WP_000547559.1 |
| Coordinates | 4643281..4643592 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NMK58_RS24120 | Protein ID | WP_000126294.1 |
| Coordinates | 4642865..4643284 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK58_RS24100 (4637915) | 4637915..4638442 | - | 528 | WP_001078781.1 | electron transport protein HydN | - |
| NMK58_RS24105 (4638591) | 4638591..4639601 | - | 1011 | WP_001377591.1 | DNA-binding transcriptional regulator AscG | - |
| NMK58_RS24110 (4639861) | 4639861..4641318 | + | 1458 | WP_024017722.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| NMK58_RS24115 (4641327) | 4641327..4642751 | + | 1425 | WP_000110313.1 | 6-phospho-beta-glucosidase AscB | - |
| NMK58_RS24120 (4642865) | 4642865..4643284 | - | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NMK58_RS24125 (4643281) | 4643281..4643592 | - | 312 | WP_000547559.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NMK58_RS24130 (4643766) | 4643766..4644509 | - | 744 | WP_001341829.1 | hypothetical protein | - |
| NMK58_RS24135 (4644552) | 4644552..4645022 | - | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| NMK58_RS24140 (4645015) | 4645015..4645425 | - | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| NMK58_RS24145 (4645422) | 4645422..4646189 | - | 768 | WP_000067401.1 | formate hydrogenlyase subunit HycG | - |
| NMK58_RS24150 (4646189) | 4646189..4646731 | - | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
| NMK58_RS24155 (4646741) | 4646741..4648450 | - | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12450.11 Da Isoelectric Point: 9.7249
>T251818 WP_000547559.1 NZ_CP101292:c4643592-4643281 [Escherichia coli]
MHIISKAPFEESARKYPNDALAHQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALAHQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT251818 WP_000126294.1 NZ_CP101292:c4643284-4642865 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|