Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 2764669..2765040 | Replicon | chromosome |
Accession | NZ_CP101292 | ||
Organism | Escherichia coli strain 2003-3014 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | A0A0D6ZRD3 |
Locus tag | NMK58_RS14345 | Protein ID | WP_001443846.1 |
Coordinates | 2764891..2765040 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 2764669..2764847 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK58_RS14320 (2760624) | 2760624..2761997 | + | 1374 | WP_000123745.1 | ATP-dependent RNA helicase DbpA | - |
NMK58_RS14325 (2762126) | 2762126..2763061 | - | 936 | WP_001157407.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
NMK58_RS14330 (2763113) | 2763113..2764348 | - | 1236 | WP_000040851.1 | site-specific integrase | - |
NMK58_RS14335 (2764350) | 2764350..2764565 | - | 216 | WP_000079604.1 | excisionase XisR | - |
- (2764669) | 2764669..2764847 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2764669) | 2764669..2764847 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2764669) | 2764669..2764847 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2764669) | 2764669..2764847 | + | 179 | NuclAT_0 | - | Antitoxin |
NMK58_RS14340 (2764665) | 2764665..2764853 | - | 189 | WP_001302840.1 | DUF1187 family protein | - |
NMK58_RS14345 (2764891) | 2764891..2765040 | - | 150 | WP_001443846.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
NMK58_RS14350 (2765096) | 2765096..2765905 | - | 810 | WP_000166313.1 | recombination protein RecT | - |
NMK58_RS14355 (2765898) | 2765898..2768498 | - | 2601 | WP_000105150.1 | exodeoxyribonuclease VIII | - |
NMK58_RS14360 (2768600) | 2768600..2768875 | - | 276 | WP_000632297.1 | protein RacC | - |
NMK58_RS14365 (2768950) | 2768950..2769120 | - | 171 | WP_001352098.1 | YdaE family protein | - |
NMK58_RS14370 (2769120) | 2769120..2769341 | - | 222 | WP_000560223.1 | killing protein KilR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | espX7/nleL | 2755859..2813076 | 57217 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5383.12 Da Isoelectric Point: 8.3398
>T251804 WP_001443846.1 NZ_CP101292:c2765040-2764891 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALER
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALER
Download Length: 150 bp
Antitoxin
Download Length: 179 bp
>AT251804 NZ_CP101292:2764669-2764847 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|