Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 2439203..2439998 | Replicon | chromosome |
Accession | NZ_CP101292 | ||
Organism | Escherichia coli strain 2003-3014 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | B7UP43 |
Locus tag | NMK58_RS12460 | Protein ID | WP_000854914.1 |
Coordinates | 2439624..2439998 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A7U9LM11 |
Locus tag | NMK58_RS12455 | Protein ID | WP_001280953.1 |
Coordinates | 2439203..2439577 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK58_RS12425 (2434558) | 2434558..2435463 | + | 906 | WP_000203541.1 | diguanylate cyclase regulator RdcB family protein | - |
NMK58_RS12430 (2435460) | 2435460..2436530 | + | 1071 | WP_000102669.1 | patatin-like phospholipase family protein | - |
NMK58_RS12435 (2436870) | 2436870..2437688 | + | 819 | WP_001234682.1 | DUF932 domain-containing protein | - |
NMK58_RS12440 (2437779) | 2437779..2438264 | + | 486 | WP_000214398.1 | antirestriction protein | - |
NMK58_RS12445 (2438280) | 2438280..2438756 | + | 477 | WP_001186738.1 | RadC family protein | - |
NMK58_RS12450 (2438819) | 2438819..2439040 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
NMK58_RS12455 (2439203) | 2439203..2439577 | + | 375 | WP_001280953.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NMK58_RS12460 (2439624) | 2439624..2439998 | + | 375 | WP_000854914.1 | TA system toxin CbtA family protein | Toxin |
NMK58_RS12465 (2439995) | 2439995..2440486 | + | 492 | WP_000976857.1 | DUF5983 family protein | - |
NMK58_RS12470 (2440498) | 2440498..2440695 | + | 198 | WP_000839282.1 | DUF957 domain-containing protein | - |
NMK58_RS12475 (2440780) | 2440780..2441622 | + | 843 | WP_001280481.1 | DUF4942 domain-containing protein | - |
NMK58_RS12485 (2442093) | 2442093..2443031 | + | 939 | WP_000351317.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
NMK58_RS12490 (2443086) | 2443086..2443823 | + | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
NMK58_RS12495 (2443847) | 2443847..2444401 | + | 555 | WP_001001902.1 | molecular chaperone YcdY | - |
NMK58_RS12500 (2444503) | 2444503..2444994 | + | 492 | WP_001297187.1 | DUF1097 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | csgG / csgF / csgE / csgD / csgB / csgA / csgC | 2438280..2450559 | 12279 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14117.17 Da Isoelectric Point: 7.7761
>T251803 WP_000854914.1 NZ_CP101292:2439624-2439998 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13734.56 Da Isoelectric Point: 6.6249
>AT251803 WP_001280953.1 NZ_CP101292:2439203-2439577 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLNAKGLTCEADTLGSCGYVYLAVYPTPALATTS
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLNAKGLTCEADTLGSCGYVYLAVYPTPALATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LXR5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LM11 |