251802

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2160985..2161205 Replicon chromosome
Accession NZ_CP101292
Organism Escherichia coli strain 2003-3014

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag NMK58_RS10870 Protein ID WP_000170954.1
Coordinates 2160985..2161092 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2161142..2161205 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMK58_RS10845 (2156829) 2156829..2157911 + 1083 WP_000804726.1 peptide chain release factor 1 -
NMK58_RS10850 (2157911) 2157911..2158744 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
NMK58_RS10855 (2158741) 2158741..2159133 + 393 WP_000200378.1 invasion regulator SirB2 -
NMK58_RS10860 (2159137) 2159137..2159946 + 810 WP_001257045.1 invasion regulator SirB1 -
NMK58_RS10865 (2159982) 2159982..2160836 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
NMK58_RS10870 (2160985) 2160985..2161092 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2161142) 2161142..2161205 + 64 NuclAT_32 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_32 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_32 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_32 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_35 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_35 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_35 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_35 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_38 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_38 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_38 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_38 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_41 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_41 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_41 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_41 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_44 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_44 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_44 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_44 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_47 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_47 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_47 - Antitoxin
- (2161142) 2161142..2161205 + 64 NuclAT_47 - Antitoxin
NMK58_RS10875 (2161520) 2161520..2161627 - 108 WP_000170959.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2161680) 2161680..2161741 + 62 NuclAT_31 - -
- (2161680) 2161680..2161741 + 62 NuclAT_31 - -
- (2161680) 2161680..2161741 + 62 NuclAT_31 - -
- (2161680) 2161680..2161741 + 62 NuclAT_31 - -
- (2161680) 2161680..2161741 + 62 NuclAT_34 - -
- (2161680) 2161680..2161741 + 62 NuclAT_34 - -
- (2161680) 2161680..2161741 + 62 NuclAT_34 - -
- (2161680) 2161680..2161741 + 62 NuclAT_34 - -
- (2161680) 2161680..2161741 + 62 NuclAT_37 - -
- (2161680) 2161680..2161741 + 62 NuclAT_37 - -
- (2161680) 2161680..2161741 + 62 NuclAT_37 - -
- (2161680) 2161680..2161741 + 62 NuclAT_37 - -
- (2161680) 2161680..2161741 + 62 NuclAT_40 - -
- (2161680) 2161680..2161741 + 62 NuclAT_40 - -
- (2161680) 2161680..2161741 + 62 NuclAT_40 - -
- (2161680) 2161680..2161741 + 62 NuclAT_40 - -
- (2161680) 2161680..2161741 + 62 NuclAT_43 - -
- (2161680) 2161680..2161741 + 62 NuclAT_43 - -
- (2161680) 2161680..2161741 + 62 NuclAT_43 - -
- (2161680) 2161680..2161741 + 62 NuclAT_43 - -
- (2161680) 2161680..2161741 + 62 NuclAT_46 - -
- (2161680) 2161680..2161741 + 62 NuclAT_46 - -
- (2161680) 2161680..2161741 + 62 NuclAT_46 - -
- (2161680) 2161680..2161741 + 62 NuclAT_46 - -
- (2161680) 2161680..2161743 + 64 NuclAT_17 - -
- (2161680) 2161680..2161743 + 64 NuclAT_17 - -
- (2161680) 2161680..2161743 + 64 NuclAT_17 - -
- (2161680) 2161680..2161743 + 64 NuclAT_17 - -
- (2161680) 2161680..2161743 + 64 NuclAT_19 - -
- (2161680) 2161680..2161743 + 64 NuclAT_19 - -
- (2161680) 2161680..2161743 + 64 NuclAT_19 - -
- (2161680) 2161680..2161743 + 64 NuclAT_19 - -
- (2161680) 2161680..2161743 + 64 NuclAT_21 - -
- (2161680) 2161680..2161743 + 64 NuclAT_21 - -
- (2161680) 2161680..2161743 + 64 NuclAT_21 - -
- (2161680) 2161680..2161743 + 64 NuclAT_21 - -
- (2161680) 2161680..2161743 + 64 NuclAT_23 - -
- (2161680) 2161680..2161743 + 64 NuclAT_23 - -
- (2161680) 2161680..2161743 + 64 NuclAT_23 - -
- (2161680) 2161680..2161743 + 64 NuclAT_23 - -
- (2161680) 2161680..2161743 + 64 NuclAT_25 - -
- (2161680) 2161680..2161743 + 64 NuclAT_25 - -
- (2161680) 2161680..2161743 + 64 NuclAT_25 - -
- (2161680) 2161680..2161743 + 64 NuclAT_25 - -
- (2161680) 2161680..2161743 + 64 NuclAT_27 - -
- (2161680) 2161680..2161743 + 64 NuclAT_27 - -
- (2161680) 2161680..2161743 + 64 NuclAT_27 - -
- (2161680) 2161680..2161743 + 64 NuclAT_27 - -
NMK58_RS10880 (2162056) 2162056..2162163 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2162211) 2162211..2162276 + 66 NuclAT_30 - -
- (2162211) 2162211..2162276 + 66 NuclAT_30 - -
- (2162211) 2162211..2162276 + 66 NuclAT_30 - -
- (2162211) 2162211..2162276 + 66 NuclAT_30 - -
- (2162211) 2162211..2162276 + 66 NuclAT_33 - -
- (2162211) 2162211..2162276 + 66 NuclAT_33 - -
- (2162211) 2162211..2162276 + 66 NuclAT_33 - -
- (2162211) 2162211..2162276 + 66 NuclAT_33 - -
- (2162211) 2162211..2162276 + 66 NuclAT_36 - -
- (2162211) 2162211..2162276 + 66 NuclAT_36 - -
- (2162211) 2162211..2162276 + 66 NuclAT_36 - -
- (2162211) 2162211..2162276 + 66 NuclAT_36 - -
- (2162211) 2162211..2162276 + 66 NuclAT_39 - -
- (2162211) 2162211..2162276 + 66 NuclAT_39 - -
- (2162211) 2162211..2162276 + 66 NuclAT_39 - -
- (2162211) 2162211..2162276 + 66 NuclAT_39 - -
- (2162211) 2162211..2162276 + 66 NuclAT_42 - -
- (2162211) 2162211..2162276 + 66 NuclAT_42 - -
- (2162211) 2162211..2162276 + 66 NuclAT_42 - -
- (2162211) 2162211..2162276 + 66 NuclAT_42 - -
- (2162211) 2162211..2162276 + 66 NuclAT_45 - -
- (2162211) 2162211..2162276 + 66 NuclAT_45 - -
- (2162211) 2162211..2162276 + 66 NuclAT_45 - -
- (2162211) 2162211..2162276 + 66 NuclAT_45 - -
- (2162211) 2162211..2162278 + 68 NuclAT_16 - -
- (2162211) 2162211..2162278 + 68 NuclAT_16 - -
- (2162211) 2162211..2162278 + 68 NuclAT_16 - -
- (2162211) 2162211..2162278 + 68 NuclAT_16 - -
- (2162211) 2162211..2162278 + 68 NuclAT_18 - -
- (2162211) 2162211..2162278 + 68 NuclAT_18 - -
- (2162211) 2162211..2162278 + 68 NuclAT_18 - -
- (2162211) 2162211..2162278 + 68 NuclAT_18 - -
- (2162211) 2162211..2162278 + 68 NuclAT_20 - -
- (2162211) 2162211..2162278 + 68 NuclAT_20 - -
- (2162211) 2162211..2162278 + 68 NuclAT_20 - -
- (2162211) 2162211..2162278 + 68 NuclAT_20 - -
- (2162211) 2162211..2162278 + 68 NuclAT_22 - -
- (2162211) 2162211..2162278 + 68 NuclAT_22 - -
- (2162211) 2162211..2162278 + 68 NuclAT_22 - -
- (2162211) 2162211..2162278 + 68 NuclAT_22 - -
- (2162211) 2162211..2162278 + 68 NuclAT_24 - -
- (2162211) 2162211..2162278 + 68 NuclAT_24 - -
- (2162211) 2162211..2162278 + 68 NuclAT_24 - -
- (2162211) 2162211..2162278 + 68 NuclAT_24 - -
- (2162211) 2162211..2162278 + 68 NuclAT_26 - -
- (2162211) 2162211..2162278 + 68 NuclAT_26 - -
- (2162211) 2162211..2162278 + 68 NuclAT_26 - -
- (2162211) 2162211..2162278 + 68 NuclAT_26 - -
NMK58_RS10885 (2162568) 2162568..2163668 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
NMK58_RS10890 (2163938) 2163938..2164168 + 231 WP_001146442.1 putative cation transport regulator ChaB -
NMK58_RS10895 (2164326) 2164326..2165021 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
NMK58_RS10900 (2165065) 2165065..2165418 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T251802 WP_000170954.1 NZ_CP101292:c2161092-2160985 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 64 bp

>AT251802 NZ_CP101292:2161142-2161205 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References