Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2160985..2161205 | Replicon | chromosome |
| Accession | NZ_CP101292 | ||
| Organism | Escherichia coli strain 2003-3014 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1PGT3 |
| Locus tag | NMK58_RS10870 | Protein ID | WP_000170954.1 |
| Coordinates | 2160985..2161092 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2161142..2161205 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK58_RS10845 (2156829) | 2156829..2157911 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| NMK58_RS10850 (2157911) | 2157911..2158744 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| NMK58_RS10855 (2158741) | 2158741..2159133 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| NMK58_RS10860 (2159137) | 2159137..2159946 | + | 810 | WP_001257045.1 | invasion regulator SirB1 | - |
| NMK58_RS10865 (2159982) | 2159982..2160836 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| NMK58_RS10870 (2160985) | 2160985..2161092 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_32 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_32 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_32 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_32 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_35 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_35 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_35 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_35 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_38 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_38 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_38 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_38 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_41 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_41 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_41 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_41 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_44 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_44 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_44 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_44 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_47 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_47 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_47 | - | Antitoxin |
| - (2161142) | 2161142..2161205 | + | 64 | NuclAT_47 | - | Antitoxin |
| NMK58_RS10875 (2161520) | 2161520..2161627 | - | 108 | WP_000170959.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_31 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_31 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_31 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_31 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_34 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_34 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_34 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_34 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_37 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_37 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_37 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_37 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_40 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_40 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_40 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_40 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_43 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_43 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_43 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_43 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_46 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_46 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_46 | - | - |
| - (2161680) | 2161680..2161741 | + | 62 | NuclAT_46 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_17 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_17 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_17 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_17 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_19 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_19 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_19 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_19 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_21 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_21 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_21 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_21 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_23 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_23 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_23 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_23 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_25 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_25 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_25 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_25 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_27 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_27 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_27 | - | - |
| - (2161680) | 2161680..2161743 | + | 64 | NuclAT_27 | - | - |
| NMK58_RS10880 (2162056) | 2162056..2162163 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_30 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_30 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_30 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_30 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_33 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_33 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_33 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_33 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_36 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_36 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_36 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_36 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_39 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_39 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_39 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_39 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_42 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_42 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_42 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_42 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_45 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_45 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_45 | - | - |
| - (2162211) | 2162211..2162276 | + | 66 | NuclAT_45 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_16 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_16 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_16 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_16 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_18 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_18 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_18 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_18 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_20 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_20 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_20 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_20 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_22 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_22 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_22 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_22 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_24 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_24 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_24 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_24 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_26 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_26 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_26 | - | - |
| - (2162211) | 2162211..2162278 | + | 68 | NuclAT_26 | - | - |
| NMK58_RS10885 (2162568) | 2162568..2163668 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| NMK58_RS10890 (2163938) | 2163938..2164168 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| NMK58_RS10895 (2164326) | 2164326..2165021 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| NMK58_RS10900 (2165065) | 2165065..2165418 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T251802 WP_000170954.1 NZ_CP101292:c2161092-2160985 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 64 bp
>AT251802 NZ_CP101292:2161142-2161205 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
