Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
| Location | 1058356..1058891 | Replicon | chromosome |
| Accession | NZ_CP101292 | ||
| Organism | Escherichia coli strain 2003-3014 | ||
Toxin (Protein)
| Gene name | yafQ | Uniprot ID | A0A0F3UZU8 |
| Locus tag | NMK58_RS05020 | Protein ID | WP_032183258.1 |
| Coordinates | 1058356..1058643 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | S1EWQ0 |
| Locus tag | NMK58_RS05025 | Protein ID | WP_000729704.1 |
| Coordinates | 1058631..1058891 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK58_RS05005 (1055938) | 1055938..1056516 | + | 579 | WP_000284050.1 | D-sedoheptulose 7-phosphate isomerase | - |
| NMK58_RS05010 (1056722) | 1056722..1057489 | + | 768 | WP_000333380.1 | class II glutamine amidotransferase | - |
| NMK58_RS05015 (1057460) | 1057460..1058200 | - | 741 | WP_001225679.1 | peptidoglycan meso-diaminopimelic acid protein amidase | - |
| NMK58_RS05020 (1058356) | 1058356..1058643 | - | 288 | WP_032183258.1 | type II toxin-antitoxin system mRNA interferase toxin YafQ | Toxin |
| NMK58_RS05025 (1058631) | 1058631..1058891 | - | 261 | WP_000729704.1 | type II toxin-antitoxin system antitoxin DinJ | Antitoxin |
| NMK58_RS05030 (1059077) | 1059077..1059850 | + | 774 | WP_000543897.1 | C40 family peptidase | - |
| NMK58_RS05035 (1059907) | 1059907..1060263 | - | 357 | WP_001030484.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| NMK58_RS05040 (1060256) | 1060256..1060534 | - | 279 | WP_000598760.1 | type II toxin-antitoxin system HicA family toxin | - |
| NMK58_RS05045 (1060639) | 1060639..1062732 | - | 2094 | WP_001140806.1 | flagellar biosynthesis protein FlhA | - |
| NMK58_RS05050 (1062716) | 1062716..1063855 | - | 1140 | WP_000785656.1 | flagellar type III secretion system protein FlhB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11166.96 Da Isoelectric Point: 10.2267
>T251799 WP_032183258.1 NZ_CP101292:c1058643-1058356 [Escherichia coli]
IRNLNQRDIEYSGQFSKDVKLAQKRHKDMNKLKYLMTLLINNALPLPAVYKDHPLQGSWKGYRDAHVEPDWILIYKLTDK
LLRFERTGTHAALFG
IRNLNQRDIEYSGQFSKDVKLAQKRHKDMNKLKYLMTLLINNALPLPAVYKDHPLQGSWKGYRDAHVEPDWILIYKLTDK
LLRFERTGTHAALFG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0F3UZU8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4ML0 | |
| AlphaFold DB | A0A0E0Y6Z6 |