Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 711285..711697 | Replicon | chromosome |
Accession | NZ_CP101292 | ||
Organism | Escherichia coli strain 2003-3014 |
Toxin (Protein)
Gene name | symE | Uniprot ID | A0A0F3WCK2 |
Locus tag | NMK58_RS03420 | Protein ID | WP_000132621.1 |
Coordinates | 711285..711626 (-) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 711621..711697 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK58_RS03400 (707295) | 707295..708707 | - | 1413 | WP_024017780.1 | PLP-dependent aminotransferase family protein | - |
NMK58_RS03405 (708884) | 708884..709048 | + | 165 | WP_000394276.1 | DUF1127 domain-containing protein | - |
NMK58_RS03410 (709145) | 709145..710027 | + | 883 | Protein_661 | DUF262 domain-containing protein | - |
NMK58_RS03415 (710075) | 710075..711238 | + | 1164 | WP_071531326.1 | DUF1524 domain-containing protein | - |
NMK58_RS03420 (711285) | 711285..711626 | - | 342 | WP_000132621.1 | endoribonuclease SymE | Toxin |
- (711621) | 711621..711697 | + | 77 | NuclAT_28 | - | Antitoxin |
- (711621) | 711621..711697 | + | 77 | NuclAT_28 | - | Antitoxin |
- (711621) | 711621..711697 | + | 77 | NuclAT_28 | - | Antitoxin |
- (711621) | 711621..711697 | + | 77 | NuclAT_28 | - | Antitoxin |
- (711621) | 711621..711697 | + | 77 | NuclAT_29 | - | Antitoxin |
- (711621) | 711621..711697 | + | 77 | NuclAT_29 | - | Antitoxin |
- (711621) | 711621..711697 | + | 77 | NuclAT_29 | - | Antitoxin |
- (711621) | 711621..711697 | + | 77 | NuclAT_29 | - | Antitoxin |
NMK58_RS03425 (711847) | 711847..713616 | - | 1770 | WP_000110079.1 | restriction endonuclease subunit S | - |
NMK58_RS03430 (713616) | 713616..715085 | - | 1470 | WP_001341289.1 | N-6 DNA methylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12342.12 Da Isoelectric Point: 7.8218
>T251798 WP_000132621.1 NZ_CP101292:c711626-711285 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPTAEESE
LMQSLRQVCKLSARKQKQVQDFIGVITGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPTAEESE
LMQSLRQVCKLSARKQKQVQDFIGVITGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT251798 NZ_CP101292:711621-711697 [Escherichia coli]
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|