Detailed information of TA system TA251789

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 63672..63941
• Replicon: plasmid pEC21Z014-112K
• Accession: NZ_CP101276
• Organism: Escherichia coli strain EC21Z-014

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NML17_RS25135
• Protein ID: WP_001372321.1
• Coordinates: 63816..63941 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	63672..63737 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NML17_RS25090	58715..58948	+	234	WP_071588969.1	hypothetical protein	-
NML17_RS25095	59189..59395	+	207	WP_000547971.1	hypothetical protein	-
NML17_RS25100	59421..59960	+	540	WP_009426937.1	single-stranded DNA-binding protein	-
NML17_RS25105	60022..60255	+	234	WP_000006030.1	DUF905 family protein	-
NML17_RS25110	60320..62284	+	1965	WP_021514794.1	ParB/RepB/Spo0J family partition protein	-
NML17_RS25115	62353..62787	+	435	WP_000845894.1	conjugation system SOS inhibitor PsiB	-
NML17_RS25120	62784..63546	+	763	Protein_81	plasmid SOS inhibition protein A	-
NML17_RS25125	63515..63703	-	189	WP_001299721.1	hypothetical protein	-
-	63515..63739	+	225	NuclAT_0	-	-
-	63515..63739	+	225	NuclAT_0	-	-
-	63515..63739	+	225	NuclAT_0	-	-
-	63515..63739	+	225	NuclAT_0	-	-
-	63672..63737	-	66	-	-	Antitoxin
NML17_RS25130	63725..63874	+	150	Protein_83	plasmid maintenance protein Mok	-
NML17_RS25135	63816..63941	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NML17_RS25140	64161..64391	+	231	WP_071998556.1	hypothetical protein	-
NML17_RS25145	64411..64548	-	138	Protein_86	hypothetical protein	-
NML17_RS25150	64618..64824	+	207	WP_032192990.1	hypothetical protein	-
NML17_RS25155	64849..65136	+	288	WP_000107542.1	hypothetical protein	-
NML17_RS25160	65255..66076	+	822	WP_001234469.1	DUF932 domain-containing protein	-
NML17_RS25165	66373..67020	-	648	WP_139242155.1	transglycosylase SLT domain-containing protein	-
NML17_RS25170	67306..67689	+	384	WP_001151564.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NML17_RS25175	67883..68569	+	687	WP_072652392.1	PAS domain-containing protein	-
NML17_RS25180	68663..68890	+	228	WP_001254388.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / aadA5 / qacE / sul1	-	1..111893	111893

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T251789 WP_001372321.1 NZ_CP101276:63816-63941 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT251789 NZ_CP101276:c63737-63672 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin