Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 79839..80093 | Replicon | plasmid pEC21Z014-165K |
| Accession | NZ_CP101275 | ||
| Organism | Escherichia coli strain EC21Z-014 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NML17_RS24255 | Protein ID | WP_001312851.1 |
| Coordinates | 79839..79988 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 80032..80093 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML17_RS24210 (75381) | 75381..75728 | + | 348 | Protein_72 | IS1-like element IS1A family transposase | - |
| NML17_RS24215 (75744) | 75744..76064 | - | 321 | Protein_73 | serine acetyltransferase | - |
| NML17_RS24220 (76168) | 76168..76455 | - | 288 | WP_000222760.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NML17_RS24225 (76452) | 76452..76703 | - | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| NML17_RS24230 (77667) | 77667..78524 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| NML17_RS24235 (78517) | 78517..78999 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| NML17_RS24240 (78992) | 78992..79039 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| NML17_RS24245 (79030) | 79030..79281 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| NML17_RS24250 (79298) | 79298..79555 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| NML17_RS24255 (79839) | 79839..79988 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (80032) | 80032..80093 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (80032) | 80032..80093 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (80032) | 80032..80093 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (80032) | 80032..80093 | + | 62 | NuclAT_1 | - | Antitoxin |
| NML17_RS24260 (80349) | 80349..80423 | - | 75 | Protein_82 | endonuclease | - |
| NML17_RS24265 (80669) | 80669..80881 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| NML17_RS24270 (81017) | 81017..81577 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| NML17_RS24275 (81680) | 81680..82540 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| NML17_RS24280 (82599) | 82599..83345 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA | 1..164754 | 164754 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T251779 WP_001312851.1 NZ_CP101275:c79988-79839 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT251779 NZ_CP101275:80032-80093 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
