Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4860727..4861329 | Replicon | chromosome |
Accession | NZ_CP101274 | ||
Organism | Escherichia coli strain EC21Z-014 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | NML17_RS23675 | Protein ID | WP_000897305.1 |
Coordinates | 4860727..4861038 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NML17_RS23680 | Protein ID | WP_000356397.1 |
Coordinates | 4861039..4861329 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML17_RS23645 (4855757) | 4855757..4856542 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
NML17_RS23650 (4856641) | 4856641..4857240 | + | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
NML17_RS23655 (4857234) | 4857234..4858106 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
NML17_RS23660 (4858103) | 4858103..4858540 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
NML17_RS23665 (4858585) | 4858585..4859526 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
NML17_RS23670 (4859590) | 4859590..4860498 | - | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
NML17_RS23675 (4860727) | 4860727..4861038 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
NML17_RS23680 (4861039) | 4861039..4861329 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
NML17_RS23685 (4861934) | 4861934..4862152 | + | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
NML17_RS23690 (4862372) | 4862372..4862614 | + | 243 | WP_001087409.1 | protein YiiF | - |
NML17_RS23695 (4862944) | 4862944..4863873 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
NML17_RS23700 (4863870) | 4863870..4864505 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
NML17_RS23705 (4864502) | 4864502..4865404 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T251777 WP_000897305.1 NZ_CP101274:4860727-4861038 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|