Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4044496..4045295 | Replicon | chromosome |
Accession | NZ_CP101274 | ||
Organism | Escherichia coli strain EC21Z-014 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | F4VJD3 |
Locus tag | NML17_RS19710 | Protein ID | WP_000347266.1 |
Coordinates | 4044831..4045295 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | NML17_RS19705 | Protein ID | WP_001307405.1 |
Coordinates | 4044496..4044831 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML17_RS19690 (4040281) | 4040281..4041051 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
NML17_RS19695 (4041067) | 4041067..4042401 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
NML17_RS19700 (4042776) | 4042776..4044347 | + | 1572 | WP_001273741.1 | galactarate dehydratase | - |
NML17_RS19705 (4044496) | 4044496..4044831 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NML17_RS19710 (4044831) | 4044831..4045295 | + | 465 | WP_000347266.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NML17_RS19715 (4045350) | 4045350..4046159 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NML17_RS19720 (4046408) | 4046408..4047688 | + | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NML17_RS19725 (4047711) | 4047711..4048184 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NML17_RS19730 (4048195) | 4048195..4048974 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NML17_RS19735 (4048964) | 4048964..4049842 | + | 879 | WP_001315856.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NML17_RS19740 (4049860) | 4049860..4050294 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4033508..4045295 | 11787 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17841.18 Da Isoelectric Point: 9.4947
>T251774 WP_000347266.1 NZ_CP101274:4044831-4045295 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A836NGD2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |