Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 2074623..2074994 | Replicon | chromosome |
Accession | NZ_CP101274 | ||
Organism | Escherichia coli strain EC21Z-014 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | F4VC37 |
Locus tag | NML17_RS10095 | Protein ID | WP_001317028.1 |
Coordinates | 2074800..2074994 (-) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 2074623..2074801 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML17_RS10070 (2070578) | 2070578..2071951 | + | 1374 | WP_000123745.1 | ATP-dependent RNA helicase DbpA | - |
NML17_RS10075 (2072080) | 2072080..2073015 | - | 936 | WP_001153728.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
NML17_RS10080 (2073067) | 2073067..2074302 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
NML17_RS10085 (2074304) | 2074304..2074519 | - | 216 | WP_000079604.1 | excisionase XisR | - |
- (2074623) | 2074623..2074801 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2074623) | 2074623..2074801 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2074623) | 2074623..2074801 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2074623) | 2074623..2074801 | + | 179 | NuclAT_0 | - | Antitoxin |
NML17_RS10090 (2074598) | 2074598..2074807 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
NML17_RS10095 (2074800) | 2074800..2074994 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
NML17_RS10100 (2075051) | 2075051..2075860 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
NML17_RS10105 (2075853) | 2075853..2078453 | - | 2601 | WP_001532611.1 | exodeoxyribonuclease VIII | - |
NML17_RS10110 (2078555) | 2078555..2078830 | - | 276 | WP_000632297.1 | protein RacC | - |
NML17_RS10115 (2078905) | 2078905..2079075 | - | 171 | WP_001352098.1 | YdaE family protein | - |
NML17_RS10120 (2079075) | 2079075..2079296 | - | 222 | WP_000560225.1 | killing protein KilR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T251761 WP_001317028.1 NZ_CP101274:c2074994-2074800 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT251761 NZ_CP101274:2074623-2074801 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|