Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 93012..93433 | Replicon | plasmid pEC21Z048-116K |
Accession | NZ_CP101270 | ||
Organism | Escherichia coli strain EC21Z-048 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | NML18_RS23910 | Protein ID | WP_096937776.1 |
Coordinates | 93012..93137 (-) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 93235..93433 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML18_RS23875 (88409) | 88409..89098 | - | 690 | WP_254837473.1 | conjugal transfer transcriptional regulator TraJ | - |
NML18_RS23880 (89285) | 89285..89668 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
NML18_RS23885 (90001) | 90001..90591 | + | 591 | WP_175345273.1 | transglycosylase SLT domain-containing protein | - |
NML18_RS23890 (90887) | 90887..91708 | - | 822 | WP_001234417.1 | DUF932 domain-containing protein | - |
NML18_RS23895 (91827) | 91827..92114 | - | 288 | WP_000107542.1 | hypothetical protein | - |
NML18_RS23900 (92139) | 92139..92345 | - | 207 | WP_000547965.1 | hypothetical protein | - |
NML18_RS23905 (92415) | 92415..92711 | + | 297 | Protein_113 | hypothetical protein | - |
NML18_RS23910 (93012) | 93012..93137 | - | 126 | WP_096937776.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
NML18_RS23915 (93079) | 93079..93228 | - | 150 | Protein_115 | DUF5431 family protein | - |
- (93235) | 93235..93433 | - | 199 | NuclAT_0 | - | Antitoxin |
- (93235) | 93235..93433 | - | 199 | NuclAT_0 | - | Antitoxin |
- (93235) | 93235..93433 | - | 199 | NuclAT_0 | - | Antitoxin |
- (93235) | 93235..93433 | - | 199 | NuclAT_0 | - | Antitoxin |
NML18_RS23920 (93402) | 93402..94164 | - | 763 | Protein_116 | plasmid SOS inhibition protein A | - |
NML18_RS23925 (94161) | 94161..94595 | - | 435 | WP_000845928.1 | conjugation system SOS inhibitor PsiB | - |
NML18_RS23930 (94650) | 94650..96608 | - | 1959 | WP_000117173.1 | ParB/RepB/Spo0J family partition protein | - |
NML18_RS23935 (96674) | 96674..96907 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
NML18_RS23940 (96964) | 96964..97503 | - | 540 | WP_000290801.1 | single-stranded DNA-binding protein | - |
NML18_RS23945 (97821) | 97821..98330 | + | 510 | WP_071594366.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | faeI / faeH / faeF / faeE / faeD / faeC | 1..115682 | 115682 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4806.72 Da Isoelectric Point: 8.4890
>T251751 WP_096937776.1 NZ_CP101270:c93137-93012 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 199 bp
>AT251751 NZ_CP101270:c93433-93235 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|