Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 55175..55429 | Replicon | plasmid pEC21Z048-116K |
| Accession | NZ_CP101270 | ||
| Organism | Escherichia coli strain EC21Z-048 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NML18_RS23680 | Protein ID | WP_001312851.1 |
| Coordinates | 55175..55324 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 55368..55429 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML18_RS23635 (50618) | 50618..50809 | + | 192 | WP_032174713.1 | FaeA/PapI family transcriptional regulator | - |
| NML18_RS23640 (50964) | 50964..51329 | + | 366 | WP_254837471.1 | hypothetical protein | - |
| NML18_RS23645 (51329) | 51329..51424 | + | 96 | Protein_61 | hypothetical protein | - |
| NML18_RS23650 (51474) | 51474..51755 | - | 282 | WP_000780224.1 | helix-turn-helix transcriptional regulator | - |
| NML18_RS23655 (51736) | 51736..52065 | - | 330 | WP_009309978.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NML18_RS23660 (53001) | 53001..53858 | - | 858 | WP_227452093.1 | incFII family plasmid replication initiator RepA | - |
| NML18_RS23665 (53851) | 53851..54333 | - | 483 | WP_001443034.1 | hypothetical protein | - |
| NML18_RS23670 (54326) | 54326..54400 | - | 75 | WP_001442103.1 | RepA leader peptide Tap | - |
| NML18_RS23675 (54634) | 54634..54891 | - | 258 | WP_000083834.1 | replication regulatory protein RepA | - |
| NML18_RS23680 (55175) | 55175..55324 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (55368) | 55368..55429 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (55368) | 55368..55429 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (55368) | 55368..55429 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (55368) | 55368..55429 | + | 62 | NuclAT_1 | - | Antitoxin |
| NML18_RS23685 (55725) | 55725..56036 | + | 312 | WP_000802277.1 | hypothetical protein | - |
| NML18_RS23690 (56217) | 56217..56303 | - | 87 | Protein_70 | endonuclease | - |
| NML18_RS23695 (56501) | 56501..56689 | - | 189 | WP_001490801.1 | hypothetical protein | - |
| NML18_RS23700 (56824) | 56824..57384 | - | 561 | WP_000139310.1 | fertility inhibition protein FinO | - |
| NML18_RS23705 (57439) | 57439..58185 | - | 747 | WP_000205776.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | faeI / faeH / faeF / faeE / faeD / faeC | 1..115682 | 115682 | |
| - | flank | IS/Tn | - | - | 51329..51460 | 131 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T251749 WP_001312851.1 NZ_CP101270:c55324-55175 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT251749 NZ_CP101270:55368-55429 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|