Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4602225..4602827 | Replicon | chromosome |
Accession | NZ_CP101269 | ||
Organism | Escherichia coli strain EC21Z-048 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | NML18_RS22335 | Protein ID | WP_000897305.1 |
Coordinates | 4602516..4602827 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NML18_RS22330 | Protein ID | WP_000356397.1 |
Coordinates | 4602225..4602515 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML18_RS22305 (4598151) | 4598151..4599053 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
NML18_RS22310 (4599050) | 4599050..4599685 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
NML18_RS22315 (4599682) | 4599682..4600611 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
NML18_RS22320 (4600941) | 4600941..4601183 | - | 243 | WP_001086388.1 | protein YiiF | - |
NML18_RS22325 (4601402) | 4601402..4601620 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
NML18_RS22330 (4602225) | 4602225..4602515 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
NML18_RS22335 (4602516) | 4602516..4602827 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
NML18_RS22340 (4603056) | 4603056..4603964 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
NML18_RS22345 (4604028) | 4604028..4604969 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
NML18_RS22350 (4605014) | 4605014..4605451 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
NML18_RS22355 (4605448) | 4605448..4606320 | - | 873 | WP_160189261.1 | virulence factor BrkB family protein | - |
NML18_RS22360 (4606314) | 4606314..4606913 | - | 600 | WP_001315111.1 | glucose-1-phosphatase | - |
NML18_RS22365 (4607012) | 4607012..4607797 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T251747 WP_000897305.1 NZ_CP101269:c4602827-4602516 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|