Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 594923..595722 | Replicon | chromosome |
Accession | NZ_CP101269 | ||
Organism | Escherichia coli strain EC21Z-048 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | U9XVR9 |
Locus tag | NML18_RS02915 | Protein ID | WP_000347267.1 |
Coordinates | 594923..595387 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | NML18_RS02920 | Protein ID | WP_001307405.1 |
Coordinates | 595387..595722 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML18_RS02890 (590376) | 590376..591254 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NML18_RS02895 (591244) | 591244..592023 | - | 780 | WP_254837356.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NML18_RS02900 (592034) | 592034..592507 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NML18_RS02905 (592530) | 592530..593810 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NML18_RS02910 (594059) | 594059..594868 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NML18_RS02915 (594923) | 594923..595387 | - | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NML18_RS02920 (595387) | 595387..595722 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NML18_RS02925 (595871) | 595871..597442 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
NML18_RS02930 (597817) | 597817..599151 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
NML18_RS02935 (599167) | 599167..599937 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 588586..607657 | 19071 | |
- | flank | IS/Tn | - | - | 589033..590241 | 1208 | |
- | inside | Genomic island | - | - | 580297..607657 | 27360 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T251730 WP_000347267.1 NZ_CP101269:c595387-594923 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XTR4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |