Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 38969..39233 | Replicon | plasmid pEC21Z078-85K |
| Accession | NZ_CP101259 | ||
| Organism | Escherichia coli strain EC21Z-078 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | NML20_RS23760 | Protein ID | WP_001387489.1 |
| Coordinates | 39081..39233 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 38969..39029 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML20_RS23745 (35071) | 35071..36141 | - | 1071 | WP_000151590.1 | IncI1-type conjugal transfer protein TrbB | - |
| NML20_RS23750 (36160) | 36160..37368 | - | 1209 | WP_011264049.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (37548) | 37548..37605 | - | 58 | NuclAT_1 | - | - |
| - (37548) | 37548..37605 | - | 58 | NuclAT_1 | - | - |
| - (37548) | 37548..37605 | - | 58 | NuclAT_1 | - | - |
| - (37548) | 37548..37605 | - | 58 | NuclAT_1 | - | - |
| NML20_RS23755 (37675) | 37675..38760 | - | 1086 | WP_072108863.1 | protein finQ | - |
| - (38969) | 38969..39029 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (38969) | 38969..39029 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (38969) | 38969..39029 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (38969) | 38969..39029 | - | 61 | NuclAT_0 | - | Antitoxin |
| NML20_RS23760 (39081) | 39081..39233 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| NML20_RS23765 (39305) | 39305..39556 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| NML20_RS23770 (39856) | 39856..40152 | + | 297 | WP_011264046.1 | DinQ-like type I toxin DqlB | - |
| NML20_RS23775 (40217) | 40217..40393 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| NML20_RS23780 (40785) | 40785..40994 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| NML20_RS23785 (41066) | 41066..41716 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| NML20_RS23790 (41790) | 41790..43958 | - | 2169 | WP_000698357.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..85299 | 85299 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T251702 WP_001387489.1 NZ_CP101259:39081-39233 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 61 bp
>AT251702 NZ_CP101259:c39029-38969 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|