Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 95982..96215 Replicon plasmid pEC21Z078-123K
Accession NZ_CP101258
Organism Escherichia coli strain EC21Z-078

Toxin (Protein)


Gene name hok Uniprot ID -
Locus tag NML20_RS23360 Protein ID WP_001372321.1
Coordinates 95982..96107 (-) Length 42 a.a.

Antitoxin (RNA)


Gene name sok
Locus tag -
Coordinates 96184..96215 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML20_RS23320 (91356) 91356..92045 - 690 WP_000283385.1 conjugal transfer transcriptional regulator TraJ -
NML20_RS23325 (92232) 92232..92615 - 384 WP_001151524.1 conjugal transfer relaxosome DNA-binding protein TraM -
NML20_RS23330 (92936) 92936..93538 + 603 WP_000243712.1 transglycosylase SLT domain-containing protein -
NML20_RS23335 (93835) 93835..94656 - 822 WP_001234426.1 DUF932 domain-containing protein -
NML20_RS23340 (94774) 94774..95061 - 288 WP_000107535.1 hypothetical protein -
NML20_RS23345 (95086) 95086..95292 - 207 WP_000547968.1 hypothetical protein -
NML20_RS23350 (95362) 95362..95534 + 173 Protein_118 hypothetical protein -
NML20_RS23355 (95532) 95532..95762 - 231 WP_071586998.1 hypothetical protein -
NML20_RS23360 (95982) 95982..96107 - 126 WP_001372321.1 type I toxin-antitoxin system Hok family toxin Toxin
NML20_RS23365 (96049) 96049..96198 - 150 Protein_121 plasmid maintenance protein Mok -
- (96184) 96184..96215 - 32 NuclAT_1 - Antitoxin
- (96184) 96184..96215 - 32 NuclAT_1 - Antitoxin
- (96184) 96184..96215 - 32 NuclAT_1 - Antitoxin
- (96184) 96184..96215 - 32 NuclAT_1 - Antitoxin
- (97657) 97657..97854 - 198 NuclAT_0 - -
- (97657) 97657..97854 - 198 NuclAT_0 - -
- (97657) 97657..97854 - 198 NuclAT_0 - -
- (97657) 97657..97854 - 198 NuclAT_0 - -
NML20_RS23375 (97666) 97666..97854 + 189 WP_001299721.1 hypothetical protein -
NML20_RS23380 (97823) 97823..98585 - 763 Protein_124 plasmid SOS inhibition protein A -
NML20_RS23385 (98582) 98582..99016 - 435 WP_000845936.1 conjugation system SOS inhibitor PsiB -
NML20_RS23390 (99071) 99071..99268 - 198 Protein_126 hypothetical protein -
NML20_RS23395 (99296) 99296..99529 - 234 WP_000005987.1 DUF905 family protein -
NML20_RS23400 (99597) 99597..100136 - 540 WP_000290840.1 single-stranded DNA-binding protein -
NML20_RS23405 (100162) 100162..100368 - 207 WP_000275856.1 hypothetical protein -
NML20_RS23410 (100438) 100438..100518 + 81 Protein_130 hypothetical protein -
NML20_RS23415 (100701) 100701..100870 - 170 Protein_131 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid tet(A) / blaCTX-M-14 / fosA3 / aac(3)-IVa / sul2 / floR / dfrA12 / aadA2 / qacE / mph(A) / blaTEM-1B / sitABCD iutA / iucD / iucC / iucB / iucA 1..122859 122859


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(2-37)


Sequences

Toxin        


Download         Length: 42 a.a.        Molecular weight: 4780.69 Da        Isoelectric Point: 8.5110

>T251698 WP_001372321.1 NZ_CP101258:c96107-95982 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Download         Length: 126 bp

Antitoxin


Download         Length: 32 bp

>AT251698 NZ_CP101258:c96215-96184 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References