Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 83617..83871 Replicon plasmid pEC21Z078-123K
Accession NZ_CP101258
Organism Escherichia coli strain EC21Z-078

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag NML20_RS23245 Protein ID WP_001312851.1
Coordinates 83617..83766 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 83810..83871 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML20_RS23200 (79180) 79180..79581 - 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -
NML20_RS23205 (79514) 79514..79771 - 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
NML20_RS23210 (79864) 79864..80172 - 309 WP_226116723.1 CPBP family intramembrane metalloprotease -
NML20_RS23215 (80114) 80114..80506 - 393 WP_000616804.1 histidine phosphatase family protein -
NML20_RS23220 (81445) 81445..82302 - 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
NML20_RS23225 (82295) 82295..82777 - 483 WP_001273588.1 hypothetical protein -
NML20_RS23230 (82770) 82770..82817 - 48 WP_229471593.1 hypothetical protein -
NML20_RS23235 (82808) 82808..83059 + 252 WP_223195197.1 replication protein RepA -
NML20_RS23240 (83076) 83076..83333 - 258 WP_000083845.1 replication regulatory protein RepA -
NML20_RS23245 (83617) 83617..83766 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (83810) 83810..83871 + 62 NuclAT_2 - Antitoxin
- (83810) 83810..83871 + 62 NuclAT_2 - Antitoxin
- (83810) 83810..83871 + 62 NuclAT_2 - Antitoxin
- (83810) 83810..83871 + 62 NuclAT_2 - Antitoxin
NML20_RS23250 (84127) 84127..84201 - 75 Protein_98 endonuclease -
NML20_RS23255 (84447) 84447..84659 - 213 WP_001299730.1 ANR family transcriptional regulator -
NML20_RS23260 (84795) 84795..85355 - 561 WP_000139315.1 fertility inhibition protein FinO -
NML20_RS23265 (85458) 85458..86210 - 753 Protein_101 alpha/beta hydrolase -
NML20_RS23270 (86211) 86211..86384 - 174 Protein_102 type IV conjugative transfer system lipoprotein TraV -
NML20_RS23275 (86381) 86381..86632 - 252 WP_001038342.1 conjugal transfer protein TrbG -
NML20_RS23280 (86644) 86644..86841 - 198 WP_001324648.1 conjugal transfer protein TrbD -
NML20_RS23285 (86828) 86828..87418 - 591 WP_001376242.1 conjugal transfer pilus-stabilizing protein TraP -
NML20_RS23290 (87408) 87408..88835 - 1428 WP_000146685.1 F-type conjugal transfer pilus assembly protein TraB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid tet(A) / blaCTX-M-14 / fosA3 / aac(3)-IVa / sul2 / floR / dfrA12 / aadA2 / qacE / mph(A) / blaTEM-1B / sitABCD iutA / iucD / iucC / iucB / iucA 1..122859 122859


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T251694 WP_001312851.1 NZ_CP101258:c83766-83617 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT251694 NZ_CP101258:83810-83871 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References