Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3886068..3886326 | Replicon | chromosome |
| Accession | NZ_CP101257 | ||
| Organism | Escherichia coli strain EC21Z-078 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | NML20_RS18905 | Protein ID | WP_000809168.1 |
| Coordinates | 3886174..3886326 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 3886068..3886125 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML20_RS18885 | 3881116..3882447 | + | 1332 | Protein_3688 | fimbria/pilus outer membrane usher protein | - |
| NML20_RS18890 | 3882460..3883418 | + | 959 | Protein_3689 | fimbrial family protein | - |
| NML20_RS18895 | 3883457..3884356 | - | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
| NML20_RS18900 | 3884422..3885588 | - | 1167 | WP_000681360.1 | Na+/H+ antiporter NhaA | - |
| - | 3886068..3886125 | - | 58 | - | - | Antitoxin |
| NML20_RS18905 | 3886174..3886326 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| NML20_RS18910 | 3886430..3887560 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
| NML20_RS18915 | 3887649..3889565 | - | 1917 | WP_000516131.1 | molecular chaperone DnaK | - |
| NML20_RS18920 | 3889942..3890346 | + | 405 | WP_000843559.1 | DUF2541 family protein | - |
| NML20_RS18925 | 3890372..3891085 | + | 714 | WP_001102383.1 | acidic protein MsyB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T251692 WP_000809168.1 NZ_CP101257:3886174-3886326 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT251692 NZ_CP101257:c3886125-3886068 [Escherichia coli]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|