Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 95982..96215 | Replicon | plasmid pEC21Z083-123K |
| Accession | NZ_CP101252 | ||
| Organism | Escherichia coli strain EC21Z-083 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | NML21_RS23325 | Protein ID | WP_001372321.1 |
| Coordinates | 95982..96107 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 96184..96215 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML21_RS23285 (91356) | 91356..92045 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| NML21_RS23290 (92232) | 92232..92615 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| NML21_RS23295 (92936) | 92936..93538 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| NML21_RS23300 (93835) | 93835..94656 | - | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| NML21_RS23305 (94774) | 94774..95061 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| NML21_RS23310 (95086) | 95086..95292 | - | 207 | WP_000547968.1 | hypothetical protein | - |
| NML21_RS23315 (95362) | 95362..95534 | + | 173 | Protein_117 | hypothetical protein | - |
| NML21_RS23320 (95532) | 95532..95762 | - | 231 | WP_071586998.1 | hypothetical protein | - |
| NML21_RS23325 (95982) | 95982..96107 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| NML21_RS23330 (96049) | 96049..96198 | - | 150 | Protein_120 | plasmid maintenance protein Mok | - |
| - (96184) | 96184..96215 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (96184) | 96184..96215 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (96184) | 96184..96215 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (96184) | 96184..96215 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (97657) | 97657..97854 | - | 198 | NuclAT_0 | - | - |
| - (97657) | 97657..97854 | - | 198 | NuclAT_0 | - | - |
| - (97657) | 97657..97854 | - | 198 | NuclAT_0 | - | - |
| - (97657) | 97657..97854 | - | 198 | NuclAT_0 | - | - |
| NML21_RS23340 (97666) | 97666..97854 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| NML21_RS23345 (97823) | 97823..98585 | - | 763 | Protein_123 | plasmid SOS inhibition protein A | - |
| NML21_RS23350 (98582) | 98582..99016 | - | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
| NML21_RS23355 (99071) | 99071..99268 | - | 198 | Protein_125 | hypothetical protein | - |
| NML21_RS23360 (99296) | 99296..99529 | - | 234 | WP_000005987.1 | DUF905 family protein | - |
| NML21_RS23365 (99597) | 99597..100136 | - | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| NML21_RS23370 (100162) | 100162..100368 | - | 207 | WP_000275856.1 | hypothetical protein | - |
| NML21_RS23375 (100438) | 100438..100518 | + | 81 | Protein_129 | hypothetical protein | - |
| NML21_RS23380 (100701) | 100701..100870 | - | 170 | Protein_130 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | tet(A) / blaCTX-M-14 / fosA3 / aac(3)-IVa / sul2 / floR / dfrA12 / aadA2 / qacE / mph(A) / blaTEM-1B / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..122859 | 122859 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T251669 WP_001372321.1 NZ_CP101252:c96107-95982 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 32 bp
>AT251669 NZ_CP101252:c96215-96184 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|