Detailed information of TA system TA251669

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 95982..96215
• Replicon: plasmid pEC21Z083-123K
• Accession: NZ_CP101252
• Organism: Escherichia coli strain EC21Z-083

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NML21_RS23325
• Protein ID: WP_001372321.1
• Coordinates: 95982..96107 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	96184..96215 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NML21_RS23285 (91356)	91356..92045	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
NML21_RS23290 (92232)	92232..92615	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NML21_RS23295 (92936)	92936..93538	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
NML21_RS23300 (93835)	93835..94656	-	822	WP_001234426.1	DUF932 domain-containing protein	-
NML21_RS23305 (94774)	94774..95061	-	288	WP_000107535.1	hypothetical protein	-
NML21_RS23310 (95086)	95086..95292	-	207	WP_000547968.1	hypothetical protein	-
NML21_RS23315 (95362)	95362..95534	+	173	Protein_117	hypothetical protein	-
NML21_RS23320 (95532)	95532..95762	-	231	WP_071586998.1	hypothetical protein	-
NML21_RS23325 (95982)	95982..96107	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NML21_RS23330 (96049)	96049..96198	-	150	Protein_120	plasmid maintenance protein Mok	-
- (96184)	96184..96215	-	32	NuclAT_1	-	Antitoxin
- (96184)	96184..96215	-	32	NuclAT_1	-	Antitoxin
- (96184)	96184..96215	-	32	NuclAT_1	-	Antitoxin
- (96184)	96184..96215	-	32	NuclAT_1	-	Antitoxin
- (97657)	97657..97854	-	198	NuclAT_0	-	-
- (97657)	97657..97854	-	198	NuclAT_0	-	-
- (97657)	97657..97854	-	198	NuclAT_0	-	-
- (97657)	97657..97854	-	198	NuclAT_0	-	-
NML21_RS23340 (97666)	97666..97854	+	189	WP_001299721.1	hypothetical protein	-
NML21_RS23345 (97823)	97823..98585	-	763	Protein_123	plasmid SOS inhibition protein A	-
NML21_RS23350 (98582)	98582..99016	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
NML21_RS23355 (99071)	99071..99268	-	198	Protein_125	hypothetical protein	-
NML21_RS23360 (99296)	99296..99529	-	234	WP_000005987.1	DUF905 family protein	-
NML21_RS23365 (99597)	99597..100136	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
NML21_RS23370 (100162)	100162..100368	-	207	WP_000275856.1	hypothetical protein	-
NML21_RS23375 (100438)	100438..100518	+	81	Protein_129	hypothetical protein	-
NML21_RS23380 (100701)	100701..100870	-	170	Protein_130	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	tet(A) / blaCTX-M-14 / fosA3 / aac(3)-IVa / sul2 / floR / dfrA12 / aadA2 / qacE / mph(A) / blaTEM-1B / sitABCD	iutA / iucD / iucC / iucB / iucA	1..122859	122859

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T251669 WP_001372321.1 NZ_CP101252:c96107-95982 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 32 bp

>AT251669 NZ_CP101252:c96215-96184 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin