Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 83617..83871 | Replicon | plasmid pEC21Z083-123K |
Accession | NZ_CP101252 | ||
Organism | Escherichia coli strain EC21Z-083 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | NML21_RS23210 | Protein ID | WP_001312851.1 |
Coordinates | 83617..83766 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 83810..83871 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML21_RS23165 (79180) | 79180..79581 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
NML21_RS23170 (79514) | 79514..79771 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
NML21_RS23175 (79864) | 79864..80121 | - | 258 | WP_230133887.1 | CPBP family intramembrane metalloprotease | - |
NML21_RS23180 (80114) | 80114..80506 | - | 393 | WP_000616804.1 | histidine phosphatase family protein | - |
NML21_RS23185 (81445) | 81445..82302 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
NML21_RS23190 (82295) | 82295..82777 | - | 483 | WP_001273588.1 | hypothetical protein | - |
NML21_RS23195 (82770) | 82770..82817 | - | 48 | WP_229471593.1 | hypothetical protein | - |
NML21_RS23200 (82808) | 82808..83059 | + | 252 | WP_223195197.1 | replication protein RepA | - |
NML21_RS23205 (83076) | 83076..83333 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
NML21_RS23210 (83617) | 83617..83766 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
- (83810) | 83810..83871 | + | 62 | NuclAT_2 | - | Antitoxin |
- (83810) | 83810..83871 | + | 62 | NuclAT_2 | - | Antitoxin |
- (83810) | 83810..83871 | + | 62 | NuclAT_2 | - | Antitoxin |
- (83810) | 83810..83871 | + | 62 | NuclAT_2 | - | Antitoxin |
NML21_RS23215 (84127) | 84127..84201 | - | 75 | Protein_97 | endonuclease | - |
NML21_RS23220 (84447) | 84447..84659 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
NML21_RS23225 (84795) | 84795..85355 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
NML21_RS23230 (85458) | 85458..86210 | - | 753 | Protein_100 | alpha/beta hydrolase | - |
NML21_RS23235 (86211) | 86211..86384 | - | 174 | Protein_101 | type IV conjugative transfer system lipoprotein TraV | - |
NML21_RS23240 (86381) | 86381..86632 | - | 252 | WP_001038342.1 | conjugal transfer protein TrbG | - |
NML21_RS23245 (86644) | 86644..86841 | - | 198 | WP_001324648.1 | conjugal transfer protein TrbD | - |
NML21_RS23250 (86828) | 86828..87418 | - | 591 | WP_001376242.1 | conjugal transfer pilus-stabilizing protein TraP | - |
NML21_RS23255 (87408) | 87408..88835 | - | 1428 | WP_000146685.1 | F-type conjugal transfer pilus assembly protein TraB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | tet(A) / blaCTX-M-14 / fosA3 / aac(3)-IVa / sul2 / floR / dfrA12 / aadA2 / qacE / mph(A) / blaTEM-1B / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..122859 | 122859 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T251665 WP_001312851.1 NZ_CP101252:c83766-83617 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT251665 NZ_CP101252:83810-83871 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|