Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1086228..1086955 | Replicon | chromosome |
| Accession | NZ_CP101251 | ||
| Organism | Escherichia coli strain EC21Z-083 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | J7Q991 |
| Locus tag | NML21_RS05280 | Protein ID | WP_000547564.1 |
| Coordinates | 1086228..1086539 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NML21_RS05285 | Protein ID | WP_000126294.1 |
| Coordinates | 1086536..1086955 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML21_RS05250 (1081370) | 1081370..1083079 | + | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
| NML21_RS05255 (1083089) | 1083089..1083631 | + | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
| NML21_RS05260 (1083631) | 1083631..1084398 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| NML21_RS05265 (1084395) | 1084395..1084805 | + | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
| NML21_RS05270 (1084798) | 1084798..1085268 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| NML21_RS05275 (1085293) | 1085293..1086054 | + | 762 | WP_001026446.1 | hypothetical protein | - |
| NML21_RS05280 (1086228) | 1086228..1086539 | + | 312 | WP_000547564.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NML21_RS05285 (1086536) | 1086536..1086955 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NML21_RS05290 (1087069) | 1087069..1088493 | - | 1425 | WP_000110363.1 | 6-phospho-beta-glucosidase AscB | - |
| NML21_RS05295 (1088502) | 1088502..1089959 | - | 1458 | WP_001107861.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| NML21_RS05300 (1090219) | 1090219..1091229 | + | 1011 | WP_001392554.1 | DNA-binding transcriptional regulator AscG | - |
| NML21_RS05305 (1091378) | 1091378..1091905 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12426.13 Da Isoelectric Point: 9.7248
>T251655 WP_000547564.1 NZ_CP101251:1086228-1086539 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT251655 WP_000126294.1 NZ_CP101251:1086536-1086955 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|