Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3886293..3886551 | Replicon | chromosome |
| Accession | NZ_CP101245 | ||
| Organism | Escherichia coli strain EC21Z-097 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | NML22_RS18895 | Protein ID | WP_000809168.1 |
| Coordinates | 3886399..3886551 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 3886293..3886350 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML22_RS18875 | 3881341..3882672 | + | 1332 | Protein_3686 | fimbria/pilus outer membrane usher protein | - |
| NML22_RS18880 | 3882685..3883643 | + | 959 | Protein_3687 | fimbrial family protein | - |
| NML22_RS18885 | 3883682..3884581 | - | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
| NML22_RS18890 | 3884647..3885813 | - | 1167 | WP_000681360.1 | Na+/H+ antiporter NhaA | - |
| - | 3886293..3886350 | - | 58 | - | - | Antitoxin |
| NML22_RS18895 | 3886399..3886551 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| NML22_RS18900 | 3886655..3887785 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
| NML22_RS18905 | 3887874..3889790 | - | 1917 | WP_000516131.1 | molecular chaperone DnaK | - |
| NML22_RS18910 | 3890167..3890571 | + | 405 | WP_000843559.1 | DUF2541 family protein | - |
| NML22_RS18915 | 3890597..3891310 | + | 714 | WP_001102383.1 | acidic protein MsyB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T251634 WP_000809168.1 NZ_CP101245:3886399-3886551 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT251634 NZ_CP101245:c3886350-3886293 [Escherichia coli]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|