Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 38980..39244 Replicon plasmid pEC21Z101-85K
Accession NZ_CP101241
Organism Escherichia coli strain EC21Z-101

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag NML23_RS22965 Protein ID WP_001387489.1
Coordinates 39092..39244 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 38980..39040 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML23_RS22950 (35082) 35082..36152 - 1071 WP_000151590.1 IncI1-type conjugal transfer protein TrbB -
NML23_RS22955 (36171) 36171..37379 - 1209 WP_011264049.1 IncI1-type conjugal transfer protein TrbA -
- (37559) 37559..37616 - 58 NuclAT_1 - -
- (37559) 37559..37616 - 58 NuclAT_1 - -
- (37559) 37559..37616 - 58 NuclAT_1 - -
- (37559) 37559..37616 - 58 NuclAT_1 - -
NML23_RS22960 (37686) 37686..38771 - 1086 WP_072108863.1 protein finQ -
- (38980) 38980..39040 - 61 NuclAT_0 - Antitoxin
- (38980) 38980..39040 - 61 NuclAT_0 - Antitoxin
- (38980) 38980..39040 - 61 NuclAT_0 - Antitoxin
- (38980) 38980..39040 - 61 NuclAT_0 - Antitoxin
NML23_RS22965 (39092) 39092..39244 + 153 WP_001387489.1 Hok/Gef family protein Toxin
NML23_RS22970 (39316) 39316..39567 - 252 WP_001291964.1 hypothetical protein -
NML23_RS22975 (39867) 39867..40163 + 297 WP_011264046.1 DinQ-like type I toxin DqlB -
NML23_RS22980 (40228) 40228..40404 - 177 WP_001054900.1 hypothetical protein -
NML23_RS22985 (40796) 40796..41005 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
NML23_RS22990 (41077) 41077..41727 - 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -
NML23_RS22995 (41801) 41801..43969 - 2169 WP_000698357.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..85310 85310


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T251615 WP_001387489.1 NZ_CP101241:39092-39244 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 61 bp

>AT251615 NZ_CP101241:c39040-38980 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References