Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 742829..743522 | Replicon | chromosome |
| Accession | NZ_CP101240 | ||
| Organism | Escherichia coli strain EC21Z-101 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | U9ZN09 |
| Locus tag | NML23_RS03600 | Protein ID | WP_000415585.1 |
| Coordinates | 742829..743125 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | NML23_RS03605 | Protein ID | WP_000650107.1 |
| Coordinates | 743127..743522 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML23_RS03565 (737963) | 737963..738442 | + | 480 | WP_000065332.1 | Hcp family type VI secretion system effector | - |
| NML23_RS03570 (738445) | 738445..739155 | + | 711 | WP_000834030.1 | hypothetical protein | - |
| NML23_RS03575 (739162) | 739162..739494 | + | 333 | WP_000914690.1 | DUF2645 family protein | - |
| NML23_RS03580 (739540) | 739540..740889 | - | 1350 | WP_000673358.1 | quorum sensing histidine kinase QseC | - |
| NML23_RS03585 (740886) | 740886..741545 | - | 660 | WP_001221502.1 | quorum sensing response regulator transcription factor QseB | - |
| NML23_RS03590 (741697) | 741697..742089 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| NML23_RS03595 (742142) | 742142..742624 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| NML23_RS03600 (742829) | 742829..743125 | + | 297 | WP_000415585.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| NML23_RS03605 (743127) | 743127..743522 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| NML23_RS03610 (743655) | 743655..745262 | + | 1608 | WP_001375094.1 | ABC transporter substrate-binding protein | - |
| NML23_RS03615 (745400) | 745400..747658 | + | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11261.99 Da Isoelectric Point: 8.9070
>T251601 WP_000415585.1 NZ_CP101240:742829-743125 [Escherichia coli]
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT251601 WP_000650107.1 NZ_CP101240:743127-743522 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|