Detailed information of TA system TA251596

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 25957..26383
• Replicon: plasmid pEC21Z137-66K
• Accession: NZ_CP101237
• Organism: Escherichia coli strain EC21Z-137

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NML24_RS24620
• Protein ID: WP_001372321.1
• Coordinates: 26258..26383 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	25957..26181 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NML24_RS24570 (21115)	21115..21327	+	213	WP_074154109.1	hypothetical protein	-
NML24_RS24575 (21267)	21267..21497	+	231	WP_001380705.1	hypothetical protein	-
NML24_RS24580 (21738)	21738..21944	+	207	WP_000547968.1	hypothetical protein	-
NML24_RS24585 (21970)	21970..22422	+	453	WP_000290842.1	single-stranded DNA-binding protein	-
NML24_RS24590 (22484)	22484..22717	+	234	WP_063085740.1	DUF905 family protein	-
NML24_RS24595 (22782)	22782..24740	+	1959	WP_063072993.1	ParB/RepB/Spo0J family partition protein	-
NML24_RS24600 (24795)	24795..25229	+	435	WP_000845907.1	conjugation system SOS inhibitor PsiB	-
NML24_RS24605 (25226)	25226..25988	+	763	Protein_37	plasmid SOS inhibition protein A	-
NML24_RS24610 (25957)	25957..26145	-	189	WP_001299721.1	hypothetical protein	-
- (25957)	25957..26181	+	225	NuclAT_0	-	Antitoxin
- (25957)	25957..26181	+	225	NuclAT_0	-	Antitoxin
- (25957)	25957..26181	+	225	NuclAT_0	-	Antitoxin
- (25957)	25957..26181	+	225	NuclAT_0	-	Antitoxin
NML24_RS24615 (26167)	26167..26316	+	150	Protein_39	plasmid maintenance protein Mok	-
NML24_RS24620 (26258)	26258..26383	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NML24_RS24625 (26603)	26603..26833	+	231	WP_001426396.1	hypothetical protein	-
NML24_RS24630 (26831)	26831..27004	-	174	Protein_42	hypothetical protein	-
NML24_RS24635 (27074)	27074..27280	+	207	WP_000547968.1	hypothetical protein	-
NML24_RS24640 (27305)	27305..27592	+	288	WP_000107535.1	hypothetical protein	-
NML24_RS24645 (27712)	27712..28533	+	822	WP_001234469.1	DUF932 domain-containing protein	-
NML24_RS24650 (28830)	28830..29477	-	648	WP_001567347.1	transglycosylase SLT domain-containing protein	-
NML24_RS24655 (29754)	29754..30137	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NML24_RS24660 (30328)	30328..31014	+	687	WP_000332484.1	PAS domain-containing protein	-
NML24_RS24665 (31108)	31108..31335	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	-	1..65831	65831

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T251596 WP_001372321.1 NZ_CP101237:26258-26383 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT251596 NZ_CP101237:25957-26181 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin