Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 40750..41019 | Replicon | plasmid pEC21Z137-82K |
| Accession | NZ_CP101236 | ||
| Organism | Escherichia coli strain EC21Z-137 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | NML24_RS24170 | Protein ID | WP_001372321.1 |
| Coordinates | 40894..41019 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 40750..40815 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML24_RS24130 | 35752..35994 | + | 243 | WP_001365577.1 | hypothetical protein | - |
| NML24_RS24135 | 36464..36991 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
| NML24_RS24140 | 37047..37280 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
| NML24_RS24145 | 37339..39362 | + | 2024 | Protein_47 | ParB/RepB/Spo0J family partition protein | - |
| NML24_RS24150 | 39431..39865 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| NML24_RS24155 | 39862..40624 | + | 763 | Protein_49 | plasmid SOS inhibition protein A | - |
| - | 40593..40817 | + | 225 | NuclAT_0 | - | - |
| - | 40593..40817 | + | 225 | NuclAT_0 | - | - |
| - | 40593..40817 | + | 225 | NuclAT_0 | - | - |
| - | 40593..40817 | + | 225 | NuclAT_0 | - | - |
| NML24_RS24160 | 40602..40781 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 40750..40815 | - | 66 | - | - | Antitoxin |
| NML24_RS24165 | 40803..40952 | + | 150 | Protein_51 | plasmid maintenance protein Mok | - |
| NML24_RS24170 | 40894..41019 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| NML24_RS24175 | 41338..41634 | - | 297 | Protein_53 | hypothetical protein | - |
| NML24_RS24180 | 41934..42230 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| NML24_RS24185 | 42341..43162 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| NML24_RS24190 | 43459..44061 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
| NML24_RS24195 | 44384..44767 | + | 384 | WP_001354030.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| NML24_RS24200 | 44961..45632 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| NML24_RS24205 | 45769..45996 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T251594 WP_001372321.1 NZ_CP101236:40894-41019 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT251594 NZ_CP101236:c40815-40750 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|