Detailed information of TA system TA251594

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 40750..41019
• Replicon: plasmid pEC21Z137-82K
• Accession: NZ_CP101236
• Organism: Escherichia coli strain EC21Z-137

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NML24_RS24170
• Protein ID: WP_001372321.1
• Coordinates: 40894..41019 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	40750..40815 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NML24_RS24130	35752..35994	+	243	WP_001365577.1	hypothetical protein	-
NML24_RS24135	36464..36991	+	528	WP_000290793.1	single-stranded DNA-binding protein	-
NML24_RS24140	37047..37280	+	234	WP_000006004.1	DUF905 domain-containing protein	-
NML24_RS24145	37339..39362	+	2024	Protein_47	ParB/RepB/Spo0J family partition protein	-
NML24_RS24150	39431..39865	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
NML24_RS24155	39862..40624	+	763	Protein_49	plasmid SOS inhibition protein A	-
-	40593..40817	+	225	NuclAT_0	-	-
-	40593..40817	+	225	NuclAT_0	-	-
-	40593..40817	+	225	NuclAT_0	-	-
-	40593..40817	+	225	NuclAT_0	-	-
NML24_RS24160	40602..40781	-	180	WP_001309233.1	hypothetical protein	-
-	40750..40815	-	66	-	-	Antitoxin
NML24_RS24165	40803..40952	+	150	Protein_51	plasmid maintenance protein Mok	-
NML24_RS24170	40894..41019	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NML24_RS24175	41338..41634	-	297	Protein_53	hypothetical protein	-
NML24_RS24180	41934..42230	+	297	WP_001272251.1	hypothetical protein	-
NML24_RS24185	42341..43162	+	822	WP_001234445.1	DUF932 domain-containing protein	-
NML24_RS24190	43459..44061	-	603	WP_000243713.1	transglycosylase SLT domain-containing protein	-
NML24_RS24195	44384..44767	+	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NML24_RS24200	44961..45632	+	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
NML24_RS24205	45769..45996	+	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T251594 WP_001372321.1 NZ_CP101236:40894-41019 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT251594 NZ_CP101236:c40815-40750 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin