Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3539250..3539944 | Replicon | chromosome |
| Accession | NZ_CP101233 | ||
| Organism | Escherichia coli strain EC21Z-137 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | NML24_RS17315 | Protein ID | WP_001263493.1 |
| Coordinates | 3539250..3539648 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | NML24_RS17320 | Protein ID | WP_000554757.1 |
| Coordinates | 3539651..3539944 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3534910) | 3534910..3534990 | - | 81 | NuclAT_9 | - | - |
| - (3534910) | 3534910..3534990 | - | 81 | NuclAT_9 | - | - |
| - (3534910) | 3534910..3534990 | - | 81 | NuclAT_9 | - | - |
| - (3534910) | 3534910..3534990 | - | 81 | NuclAT_9 | - | - |
| NML24_RS17285 (3534250) | 3534250..3535494 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| NML24_RS17290 (3535586) | 3535586..3536044 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| NML24_RS17295 (3536305) | 3536305..3537762 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| NML24_RS17300 (3537819) | 3537819..3538340 | - | 522 | Protein_3379 | peptide chain release factor H | - |
| NML24_RS17305 (3538339) | 3538339..3538542 | - | 204 | Protein_3380 | RtcB family protein | - |
| NML24_RS17310 (3538788) | 3538788..3539240 | - | 453 | WP_180759961.1 | GNAT family N-acetyltransferase | - |
| NML24_RS17315 (3539250) | 3539250..3539648 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| NML24_RS17320 (3539651) | 3539651..3539944 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| NML24_RS17325 (3539996) | 3539996..3541051 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| NML24_RS17330 (3541122) | 3541122..3541907 | - | 786 | WP_000207564.1 | putative lateral flagellar export/assembly protein LafU | - |
| NML24_RS17335 (3541879) | 3541879..3543591 | + | 1713 | Protein_3386 | flagellar biosynthesis protein FlhA | - |
| NML24_RS17340 (3543815) | 3543815..3544312 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T251589 WP_001263493.1 NZ_CP101233:c3539648-3539250 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|