Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 735136..735829 | Replicon | chromosome |
| Accession | NZ_CP101233 | ||
| Organism | Escherichia coli strain EC21Z-137 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | NML24_RS03625 | Protein ID | WP_000415584.1 |
| Coordinates | 735136..735432 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | NML24_RS03630 | Protein ID | WP_000650107.1 |
| Coordinates | 735434..735829 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML24_RS03595 (730396) | 730396..731376 | + | 981 | WP_000019450.1 | IS5-like element ISKpn26 family transposase | - |
| NML24_RS03600 (731490) | 731490..731801 | + | 312 | WP_212403430.1 | DUF2645 family protein | - |
| NML24_RS03605 (731847) | 731847..733196 | - | 1350 | WP_000673357.1 | quorum sensing histidine kinase QseC | - |
| NML24_RS03610 (733193) | 733193..733852 | - | 660 | WP_001221502.1 | quorum sensing response regulator transcription factor QseB | - |
| NML24_RS03615 (734004) | 734004..734396 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| NML24_RS03620 (734449) | 734449..734931 | + | 483 | WP_000183489.1 | GyrI-like domain-containing protein | - |
| NML24_RS03625 (735136) | 735136..735432 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| NML24_RS03630 (735434) | 735434..735829 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| NML24_RS03635 (735962) | 735962..737569 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
| NML24_RS03640 (737707) | 737707..739965 | + | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T251579 WP_000415584.1 NZ_CP101233:735136-735432 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT251579 WP_000650107.1 NZ_CP101233:735434-735829 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|