Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 618639..619438 | Replicon | chromosome |
Accession | NZ_CP101233 | ||
Organism | Escherichia coli strain EC21Z-137 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | NML24_RS03055 | Protein ID | WP_180469665.1 |
Coordinates | 618639..619103 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | - |
Locus tag | NML24_RS03060 | Protein ID | WP_212403239.1 |
Coordinates | 619103..619438 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML24_RS03025 (613640) | 613640..614074 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
NML24_RS03030 (614092) | 614092..614970 | - | 879 | WP_180469662.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NML24_RS03035 (614960) | 614960..615739 | - | 780 | WP_212403236.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NML24_RS03040 (615750) | 615750..616223 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NML24_RS03045 (616246) | 616246..617526 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NML24_RS03050 (617775) | 617775..618584 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NML24_RS03055 (618639) | 618639..619103 | - | 465 | WP_180469665.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NML24_RS03060 (619103) | 619103..619438 | - | 336 | WP_212403239.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
NML24_RS03065 (619587) | 619587..621158 | - | 1572 | WP_032181387.1 | galactarate dehydratase | - |
NML24_RS03070 (621533) | 621533..622867 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
NML24_RS03075 (622883) | 622883..623653 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 609238..630208 | 20970 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17793.18 Da Isoelectric Point: 9.4947
>T251577 WP_180469665.1 NZ_CP101233:c619103-618639 [Escherichia coli]
MDFLQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFLQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|