Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 18228..18879 Replicon plasmid pEC21Z144-24K
Accession NZ_CP101228
Organism Escherichia coli strain EC21Z-144

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag NML25_RS27190 Protein ID WP_094283547.1
Coordinates 18529..18879 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NML25_RS27185 Protein ID WP_094283546.1
Coordinates 18228..18527 (-) Length 100 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML25_RS27145 (NML25_27140) 13700..14335 + 636 WP_000088100.1 RepA family replication protein -
NML25_RS27150 (NML25_27145) 15294..15566 + 273 WP_094283543.1 hypothetical protein -
NML25_RS27155 (NML25_27150) 15640..15939 + 300 WP_001615573.1 hypothetical protein -
NML25_RS27160 (NML25_27155) 16310..16843 + 534 WP_001025389.1 J domain-containing protein -
NML25_RS27165 (NML25_27160) 16971..17513 + 543 WP_094283544.1 hypothetical protein -
NML25_RS27170 (NML25_27165) 17550..17807 + 258 WP_024192529.1 hypothetical protein -
NML25_RS27175 (NML25_27170) 17797..18036 + 240 WP_094283545.1 hypothetical protein -
NML25_RS27180 (NML25_27175) 18111..18221 - 111 Protein_26 transcriptional regulator -
NML25_RS27185 (NML25_27180) 18228..18527 - 300 WP_094283546.1 helix-turn-helix transcriptional regulator Antitoxin
NML25_RS27190 (NML25_27185) 18529..18879 - 351 WP_094283547.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NML25_RS27195 (NML25_27190) 19191..19889 + 699 WP_249540332.1 ParA family protein -
NML25_RS27200 (NML25_27195) 19929..20162 + 234 WP_000024515.1 hypothetical protein -
NML25_RS27205 (NML25_27200) 20194..20457 - 264 WP_094283549.1 PilI type IV pilus biogenesis protein -
NML25_RS27210 (NML25_27205) 20426..20803 - 378 WP_094283550.1 hypothetical protein -
NML25_RS27215 (NML25_27210) 20800..21279 - 480 WP_094283551.1 thermonuclease family protein -
NML25_RS27220 (NML25_27215) 21283..22017 - 735 WP_094283552.1 MobC family replication-relaxation protein -
NML25_RS27225 (NML25_27220) 22027..23754 - 1728 WP_094283553.1 type IV secretory system conjugative DNA transfer family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..24263 24263


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(13-107)

Antitoxin

HigA2-like, helix-turn-helix domain

(17-87)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13408.35 Da        Isoelectric Point: 6.9806

>T251576 WP_094283547.1 NZ_CP101228:c18879-18529 [Escherichia coli]
MWNVVTTDIFDAWFLTQNEDLRESVYEAMGLLEKFGPTLGRPYVDTLNGSDFANMKELRVQYKGSPVRAFFAFDPTRNAI
VLCAGDKTGLNEKRFYKDMIKLADSEYRKHLAKLEK

Download         Length: 351 bp

Antitoxin


Download         Length: 100 a.a.        Molecular weight: 10986.70 Da        Isoelectric Point: 8.5545

>AT251576 WP_094283546.1 NZ_CP101228:c18527-18228 [Escherichia coli]
MGTYRELLAKESPEMQARVAERVEKASVQIALSALRDELNISQTELATMMGVKQPSVARMEQTDNDPRISTLKRYVKALG
GELSLDVTLPTGKRVAFHL

Download         Length: 300 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References