Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 33060..33299 | Replicon | plasmid pEC21Z144-89K |
| Accession | NZ_CP101224 | ||
| Organism | Escherichia coli strain EC21Z-144 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | NML25_RS25725 | Protein ID | WP_023144756.1 |
| Coordinates | 33060..33194 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 33239..33299 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML25_RS25685 (29080) | 29080..29481 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| NML25_RS25690 (29414) | 29414..29671 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| NML25_RS25695 (29764) | 29764..30417 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| NML25_RS25700 (30515) | 30515..30655 | - | 141 | WP_001333237.1 | hypothetical protein | - |
| NML25_RS25705 (31357) | 31357..32205 | - | 849 | WP_139471275.1 | incFII family plasmid replication initiator RepA | - |
| NML25_RS25710 (32198) | 32198..32272 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| NML25_RS25715 (32272) | 32272..32403 | - | 132 | Protein_39 | protein CopA/IncA | - |
| NML25_RS25720 (32509) | 32509..32763 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| NML25_RS25725 (33060) | 33060..33194 | - | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| - (33239) | 33239..33299 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (33239) | 33239..33299 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (33239) | 33239..33299 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (33239) | 33239..33299 | + | 61 | NuclAT_0 | - | Antitoxin |
| NML25_RS25730 (33266) | 33266..33552 | - | 287 | Protein_42 | DUF2726 domain-containing protein | - |
| NML25_RS25735 (34065) | 34065..34277 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| NML25_RS25740 (34408) | 34408..34968 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| NML25_RS25745 (35023) | 35023..35769 | - | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aac(3)-IId / blaTEM-1B | - | 1..88826 | 88826 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T251569 WP_023144756.1 NZ_CP101224:c33194-33060 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT251569 NZ_CP101224:33239-33299 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|