Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 5131267..5131869 | Replicon | chromosome |
Accession | NZ_CP101222 | ||
Organism | Escherichia coli strain EC21Z-144 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | NML25_RS24630 | Protein ID | WP_000897305.1 |
Coordinates | 5131267..5131578 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NML25_RS24635 | Protein ID | WP_000356395.1 |
Coordinates | 5131579..5131869 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML25_RS24605 (5126309) | 5126309..5126746 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
NML25_RS24610 (5126791) | 5126791..5127732 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
NML25_RS24615 (5128148) | 5128148..5129035 | + | 888 | Protein_4798 | hypothetical protein | - |
NML25_RS24620 (5129048) | 5129048..5129962 | + | 915 | WP_233304549.1 | transposase | - |
NML25_RS24625 (5130130) | 5130130..5131038 | - | 909 | WP_001550353.1 | alpha/beta hydrolase | - |
NML25_RS24630 (5131267) | 5131267..5131578 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
NML25_RS24635 (5131579) | 5131579..5131869 | + | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
NML25_RS24640 (5131954) | 5131954..5132175 | + | 222 | WP_001550354.1 | hypothetical protein | - |
NML25_RS24645 (5132227) | 5132227..5132505 | + | 279 | WP_001315112.1 | hypothetical protein | - |
NML25_RS24650 (5132924) | 5132924..5133142 | + | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
NML25_RS24655 (5133361) | 5133361..5133603 | + | 243 | WP_001309881.1 | CopG family transcriptional regulator | - |
NML25_RS24660 (5133785) | 5133785..5134714 | - | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
NML25_RS24665 (5134711) | 5134711..5135346 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
NML25_RS24670 (5135343) | 5135343..5136245 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T251564 WP_000897305.1 NZ_CP101222:5131267-5131578 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|