Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4297668..4298467 | Replicon | chromosome |
Accession | NZ_CP101222 | ||
Organism | Escherichia coli strain EC21Z-144 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | F0JQM9 |
Locus tag | NML25_RS20660 | Protein ID | WP_000347270.1 |
Coordinates | 4298003..4298467 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | A0A0V9H1L4 |
Locus tag | NML25_RS20655 | Protein ID | WP_001551693.1 |
Coordinates | 4297668..4298003 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML25_RS20640 (4293453) | 4293453..4294223 | - | 771 | WP_001551692.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
NML25_RS20645 (4294239) | 4294239..4295573 | - | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
NML25_RS20650 (4295948) | 4295948..4297519 | + | 1572 | WP_001273738.1 | galactarate dehydratase | - |
NML25_RS20655 (4297668) | 4297668..4298003 | + | 336 | WP_001551693.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NML25_RS20660 (4298003) | 4298003..4298467 | + | 465 | WP_000347270.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NML25_RS20665 (4298522) | 4298522..4299331 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NML25_RS20670 (4299580) | 4299580..4300860 | + | 1281 | WP_001551694.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NML25_RS20675 (4300883) | 4300883..4301356 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NML25_RS20680 (4301367) | 4301367..4302146 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NML25_RS20685 (4302136) | 4302136..4303014 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NML25_RS20690 (4303032) | 4303032..4303466 | + | 435 | WP_000948837.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4288906..4298467 | 9561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17806.22 Da Isoelectric Point: 9.6924
>T251562 WP_000347270.1 NZ_CP101222:4298003-4298467 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9NQ90 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9H1L4 |