Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 4168047..4168740 | Replicon | chromosome |
Accession | NZ_CP101222 | ||
Organism | Escherichia coli strain EC21Z-144 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | NML25_RS20010 | Protein ID | WP_000415584.1 |
Coordinates | 4168444..4168740 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | NML25_RS20005 | Protein ID | WP_000650107.1 |
Coordinates | 4168047..4168442 (-) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML25_RS19995 (4163911) | 4163911..4166169 | - | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
NML25_RS20000 (4166307) | 4166307..4167914 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
NML25_RS20005 (4168047) | 4168047..4168442 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
NML25_RS20010 (4168444) | 4168444..4168740 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
NML25_RS20015 (4168945) | 4168945..4169427 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
NML25_RS20020 (4169480) | 4169480..4169872 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
NML25_RS20025 (4170024) | 4170024..4170683 | + | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
NML25_RS20030 (4170680) | 4170680..4172029 | + | 1350 | WP_001551658.1 | quorum sensing histidine kinase QseC | - |
NML25_RS20035 (4172078) | 4172078..4172407 | - | 330 | WP_001551659.1 | DUF2645 family protein | - |
NML25_RS20040 (4172765) | 4172765..4173346 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
NML25_RS20045 (4173377) | 4173377..4173691 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T251561 WP_000415584.1 NZ_CP101222:c4168740-4168444 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT251561 WP_000650107.1 NZ_CP101222:c4168442-4168047 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|