Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-timR/Ldr(toxin)
Location 2038837..2039059 Replicon chromosome
Accession NZ_CP101222
Organism Escherichia coli strain EC21Z-144

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag NML25_RS09755 Protein ID WP_000170955.1
Coordinates 2038837..2038944 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name timR
Locus tag -
Coordinates 2038992..2039059 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML25_RS09725 (2034518) 2034518..2035351 + 834 WP_000456570.1 peptide chain release factor N(5)-glutamine methyltransferase -
NML25_RS09730 (2035348) 2035348..2035740 + 393 WP_000200377.1 invasion regulator SirB2 -
NML25_RS09735 (2035744) 2035744..2036553 + 810 WP_001257044.1 invasion regulator SirB1 -
NML25_RS09740 (2036589) 2036589..2037443 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
NML25_RS09745 (2037638) 2037638..2038096 + 459 WP_000526135.1 IS200/IS605-like element IS200C family transposase -
NML25_RS09750 (2038302) 2038302..2038409 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2038457) 2038457..2038523 + 67 NuclAT_30 - -
- (2038457) 2038457..2038523 + 67 NuclAT_30 - -
- (2038457) 2038457..2038523 + 67 NuclAT_30 - -
- (2038457) 2038457..2038523 + 67 NuclAT_30 - -
- (2038457) 2038457..2038523 + 67 NuclAT_34 - -
- (2038457) 2038457..2038523 + 67 NuclAT_34 - -
- (2038457) 2038457..2038523 + 67 NuclAT_34 - -
- (2038457) 2038457..2038523 + 67 NuclAT_34 - -
- (2038457) 2038457..2038523 + 67 NuclAT_38 - -
- (2038457) 2038457..2038523 + 67 NuclAT_38 - -
- (2038457) 2038457..2038523 + 67 NuclAT_38 - -
- (2038457) 2038457..2038523 + 67 NuclAT_38 - -
- (2038457) 2038457..2038523 + 67 NuclAT_42 - -
- (2038457) 2038457..2038523 + 67 NuclAT_42 - -
- (2038457) 2038457..2038523 + 67 NuclAT_42 - -
- (2038457) 2038457..2038523 + 67 NuclAT_42 - -
- (2038457) 2038457..2038523 + 67 NuclAT_43 - -
- (2038457) 2038457..2038523 + 67 NuclAT_43 - -
- (2038457) 2038457..2038523 + 67 NuclAT_43 - -
- (2038457) 2038457..2038523 + 67 NuclAT_43 - -
- (2038459) 2038459..2038524 + 66 NuclAT_12 - -
- (2038459) 2038459..2038524 + 66 NuclAT_12 - -
- (2038459) 2038459..2038524 + 66 NuclAT_12 - -
- (2038459) 2038459..2038524 + 66 NuclAT_12 - -
- (2038459) 2038459..2038524 + 66 NuclAT_14 - -
- (2038459) 2038459..2038524 + 66 NuclAT_14 - -
- (2038459) 2038459..2038524 + 66 NuclAT_14 - -
- (2038459) 2038459..2038524 + 66 NuclAT_14 - -
- (2038459) 2038459..2038524 + 66 NuclAT_16 - -
- (2038459) 2038459..2038524 + 66 NuclAT_16 - -
- (2038459) 2038459..2038524 + 66 NuclAT_16 - -
- (2038459) 2038459..2038524 + 66 NuclAT_16 - -
- (2038459) 2038459..2038524 + 66 NuclAT_18 - -
- (2038459) 2038459..2038524 + 66 NuclAT_18 - -
- (2038459) 2038459..2038524 + 66 NuclAT_18 - -
- (2038459) 2038459..2038524 + 66 NuclAT_18 - -
- (2038459) 2038459..2038524 + 66 NuclAT_20 - -
- (2038459) 2038459..2038524 + 66 NuclAT_20 - -
- (2038459) 2038459..2038524 + 66 NuclAT_20 - -
- (2038459) 2038459..2038524 + 66 NuclAT_20 - -
- (2038459) 2038459..2038524 + 66 NuclAT_22 - -
- (2038459) 2038459..2038524 + 66 NuclAT_22 - -
- (2038459) 2038459..2038524 + 66 NuclAT_22 - -
- (2038459) 2038459..2038524 + 66 NuclAT_22 - -
NML25_RS09755 (2038837) 2038837..2038944 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2038992) 2038992..2039059 + 68 NuclAT_11 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_11 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_11 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_11 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_13 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_13 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_13 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_13 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_15 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_15 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_15 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_15 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_17 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_17 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_17 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_17 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_19 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_19 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_19 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_19 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_21 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_21 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_21 - Antitoxin
- (2038992) 2038992..2039059 + 68 NuclAT_21 - Antitoxin
NML25_RS09760 (2039349) 2039349..2040449 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
NML25_RS09765 (2040719) 2040719..2040949 + 231 WP_001146444.1 putative cation transport regulator ChaB -
NML25_RS09770 (2041107) 2041107..2041802 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
NML25_RS09775 (2041846) 2041846..2042199 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
NML25_RS09780 (2042385) 2042385..2043779 + 1395 WP_001718153.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2037638..2038096 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T251550 WP_000170955.1 NZ_CP101222:c2038944-2038837 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 68 bp

>AT251550 NZ_CP101222:2038992-2039059 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References