Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 923481..924175 Replicon chromosome
Accession NZ_CP101222
Organism Escherichia coli strain EC21Z-144

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag NML25_RS04350 Protein ID WP_001263491.1
Coordinates 923777..924175 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag NML25_RS04345 Protein ID WP_000554755.1
Coordinates 923481..923774 (+) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML25_RS04320 (919102) 919102..919458 - 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -
NML25_RS04325 (919451) 919451..919729 - 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
NML25_RS04330 (919834) 919834..921546 - 1713 Protein_838 flagellar biosynthesis protein FlhA -
NML25_RS04335 (921518) 921518..922303 + 786 WP_019842510.1 putative lateral flagellar export/assembly protein LafU -
NML25_RS04340 (922374) 922374..923429 + 1056 WP_001550655.1 DNA polymerase IV -
NML25_RS04345 (923481) 923481..923774 + 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
NML25_RS04350 (923777) 923777..924175 + 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
NML25_RS04355 (924185) 924185..924637 + 453 WP_019842500.1 GNAT family N-acetyltransferase -
NML25_RS04360 (924883) 924883..925089 + 207 Protein_844 RtcB family protein -
NML25_RS04365 (925085) 925085..925437 + 353 Protein_845 peptide chain release factor H -
NML25_RS04370 (925494) 925494..926951 - 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
NML25_RS04375 (927212) 927212..927670 + 459 WP_001291990.1 xanthine phosphoribosyltransferase -
- (928266) 928266..928346 + 81 NuclAT_10 - -
- (928266) 928266..928346 + 81 NuclAT_10 - -
- (928266) 928266..928346 + 81 NuclAT_10 - -
- (928266) 928266..928346 + 81 NuclAT_10 - -
NML25_RS04380 (927762) 927762..929006 + 1245 WP_000189541.1 esterase FrsA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T251545 WP_001263491.1 NZ_CP101222:923777-924175 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT251545 WP_000554755.1 NZ_CP101222:923481-923774 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References