Detailed information of TA system TA251536

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 102147..102573
• Replicon: plasmid pEC21Z147-128K
• Accession: NZ_CP101212
• Organism: Escherichia coli strain EC21Z-147

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NML26_RS26645
• Protein ID: WP_001372321.1
• Coordinates: 102147..102272 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	102349..102573 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NML26_RS26605 (97521)	97521..98210	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
NML26_RS26610 (98397)	98397..98780	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NML26_RS26615 (99101)	99101..99703	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
NML26_RS26620 (100000)	100000..100821	-	822	WP_001234426.1	DUF932 domain-containing protein	-
NML26_RS26625 (100939)	100939..101226	-	288	WP_000107535.1	hypothetical protein	-
NML26_RS26630 (101251)	101251..101457	-	207	WP_000547968.1	hypothetical protein	-
NML26_RS26635 (101527)	101527..101699	+	173	Protein_103	hypothetical protein	-
NML26_RS26640 (101697)	101697..101927	-	231	WP_071586998.1	hypothetical protein	-
NML26_RS26645 (102147)	102147..102272	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NML26_RS26650 (102214)	102214..102363	-	150	Protein_106	plasmid maintenance protein Mok	-
- (102349)	102349..102573	-	225	NuclAT_0	-	Antitoxin
- (102349)	102349..102573	-	225	NuclAT_0	-	Antitoxin
- (102349)	102349..102573	-	225	NuclAT_0	-	Antitoxin
- (102349)	102349..102573	-	225	NuclAT_0	-	Antitoxin
NML26_RS26655 (102385)	102385..102573	+	189	WP_001299721.1	hypothetical protein	-
NML26_RS26660 (102542)	102542..103304	-	763	Protein_108	plasmid SOS inhibition protein A	-
NML26_RS26665 (103301)	103301..103735	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
NML26_RS26670 (103790)	103790..103987	-	198	Protein_110	hypothetical protein	-
NML26_RS26675 (104015)	104015..104248	-	234	WP_000005987.1	DUF905 family protein	-
NML26_RS26680 (104316)	104316..104855	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
NML26_RS26685 (104881)	104881..105087	-	207	WP_000275856.1	hypothetical protein	-
NML26_RS26690 (105157)	105157..105237	+	81	Protein_114	hypothetical protein	-
NML26_RS26695 (105420)	105420..105589	-	170	Protein_115	hypothetical protein	-
NML26_RS26700 (106226)	106226..107197	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aadA5 / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..127578	127578

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T251536 WP_001372321.1 NZ_CP101212:c102272-102147 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT251536 NZ_CP101212:c102573-102349 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin