Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 63818..64072 | Replicon | plasmid pEC21Z147-128K |
| Accession | NZ_CP101212 | ||
| Organism | Escherichia coli strain EC21Z-147 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NML26_RS26410 | Protein ID | WP_001312851.1 |
| Coordinates | 63818..63967 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 64011..64072 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML26_RS26370 (59112) | 59112..60650 | - | 1539 | WP_000099202.1 | IS66-like element ISEc22 family transposase | - |
| NML26_RS26375 (60699) | 60699..61046 | - | 348 | WP_000612626.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NML26_RS26380 (61043) | 61043..61447 | - | 405 | WP_000839181.1 | transposase | - |
| NML26_RS26385 (61646) | 61646..62503 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| NML26_RS26390 (62496) | 62496..62978 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| NML26_RS26395 (62971) | 62971..63018 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| NML26_RS26400 (63009) | 63009..63260 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| NML26_RS26405 (63277) | 63277..63534 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| NML26_RS26410 (63818) | 63818..63967 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (64011) | 64011..64072 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (64011) | 64011..64072 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (64011) | 64011..64072 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (64011) | 64011..64072 | + | 62 | NuclAT_1 | - | Antitoxin |
| NML26_RS26415 (64328) | 64328..64402 | - | 75 | Protein_59 | endonuclease | - |
| NML26_RS26420 (64648) | 64648..64860 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| NML26_RS26425 (64996) | 64996..65556 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| NML26_RS26430 (65659) | 65659..66519 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| NML26_RS26435 (66578) | 66578..67324 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..127578 | 127578 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T251531 WP_001312851.1 NZ_CP101212:c63967-63818 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT251531 NZ_CP101212:64011-64072 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
