Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4838196..4838798 | Replicon | chromosome |
Accession | NZ_CP101210 | ||
Organism | Escherichia coli strain EC21Z-147 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | NML26_RS23580 | Protein ID | WP_000897305.1 |
Coordinates | 4838487..4838798 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NML26_RS23575 | Protein ID | WP_000356397.1 |
Coordinates | 4838196..4838486 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML26_RS23555 (4834698) | 4834698..4835600 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
NML26_RS23560 (4835597) | 4835597..4836232 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
NML26_RS23565 (4836229) | 4836229..4837158 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
NML26_RS23570 (4837373) | 4837373..4837591 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
NML26_RS23575 (4838196) | 4838196..4838486 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
NML26_RS23580 (4838487) | 4838487..4838798 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
NML26_RS23585 (4839027) | 4839027..4839935 | + | 909 | WP_001318161.1 | alpha/beta hydrolase | - |
NML26_RS23590 (4839999) | 4839999..4840940 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
NML26_RS23595 (4840985) | 4840985..4841422 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
NML26_RS23600 (4841419) | 4841419..4842291 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
NML26_RS23605 (4842285) | 4842285..4842884 | - | 600 | WP_001315111.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T251529 WP_000897305.1 NZ_CP101210:c4838798-4838487 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|