Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3633734..3634413 | Replicon | chromosome |
Accession | NZ_CP101210 | ||
Organism | Escherichia coli strain EC21Z-147 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | NML26_RS17920 | Protein ID | WP_000057523.1 |
Coordinates | 3634111..3634413 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | NML26_RS17915 | Protein ID | WP_000806442.1 |
Coordinates | 3633734..3634075 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML26_RS17905 (3629977) | 3629977..3630909 | - | 933 | WP_000883024.1 | glutaminase A | - |
NML26_RS17910 (3631172) | 3631172..3633676 | + | 2505 | WP_000083999.1 | copper-exporting P-type ATPase CopA | - |
NML26_RS17915 (3633734) | 3633734..3634075 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
NML26_RS17920 (3634111) | 3634111..3634413 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NML26_RS17925 (3634546) | 3634546..3635340 | + | 795 | WP_000365161.1 | TraB/GumN family protein | - |
NML26_RS17930 (3635544) | 3635544..3636023 | + | 480 | WP_000186638.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
NML26_RS17935 (3636060) | 3636060..3637712 | - | 1653 | Protein_3512 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
NML26_RS17940 (3637930) | 3637930..3639150 | + | 1221 | WP_001251634.1 | fosmidomycin MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T251522 WP_000057523.1 NZ_CP101210:c3634413-3634111 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|