Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 688604..689403 | Replicon | chromosome |
Accession | NZ_CP101210 | ||
Organism | Escherichia coli strain EC21Z-147 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | NML26_RS03400 | Protein ID | WP_254825027.1 |
Coordinates | 688604..689068 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | NML26_RS03405 | Protein ID | WP_001296435.1 |
Coordinates | 689068..689403 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML26_RS03370 (683605) | 683605..684039 | - | 435 | WP_000948823.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
NML26_RS03375 (684057) | 684057..684935 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NML26_RS03380 (684925) | 684925..685704 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NML26_RS03385 (685715) | 685715..686188 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NML26_RS03390 (686211) | 686211..687491 | - | 1281 | WP_000681938.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NML26_RS03395 (687740) | 687740..688549 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NML26_RS03400 (688604) | 688604..689068 | - | 465 | WP_254825027.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NML26_RS03405 (689068) | 689068..689403 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NML26_RS03410 (689552) | 689552..691123 | - | 1572 | WP_001273941.1 | galactarate dehydratase | - |
NML26_RS03415 (691498) | 691498..692832 | + | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
NML26_RS03420 (692848) | 692848..693618 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17791.17 Da Isoelectric Point: 9.4947
>T251509 WP_254825027.1 NZ_CP101210:c689068-688604 [Escherichia coli]
MDFPQRINGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRINGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|