Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 22256..22907 | Replicon | plasmid pEC21Z151-24K |
| Accession | NZ_CP101202 | ||
| Organism | Escherichia coli strain EC21Z-151 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NML27_RS26255 | Protein ID | WP_094283547.1 |
| Coordinates | 22256..22606 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NML27_RS26260 | Protein ID | WP_094283546.1 |
| Coordinates | 22608..22907 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML27_RS26220 (NML27_26215) | 17381..19108 | + | 1728 | WP_094283553.1 | type IV secretory system conjugative DNA transfer family protein | - |
| NML27_RS26225 (NML27_26220) | 19118..19852 | + | 735 | WP_094283552.1 | MobC family replication-relaxation protein | - |
| NML27_RS26230 (NML27_26225) | 19856..20335 | + | 480 | WP_094283551.1 | thermonuclease family protein | - |
| NML27_RS26235 (NML27_26230) | 20332..20709 | + | 378 | WP_094283550.1 | hypothetical protein | - |
| NML27_RS26240 (NML27_26235) | 20678..20941 | + | 264 | WP_094283549.1 | PilI type IV pilus biogenesis protein | - |
| NML27_RS26245 (NML27_26240) | 20973..21206 | - | 234 | WP_000024515.1 | hypothetical protein | - |
| NML27_RS26250 (NML27_26245) | 21246..21944 | - | 699 | WP_249540332.1 | ParA family protein | - |
| NML27_RS26255 (NML27_26250) | 22256..22606 | + | 351 | WP_094283547.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NML27_RS26260 (NML27_26255) | 22608..22907 | + | 300 | WP_094283546.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NML27_RS26265 (NML27_26260) | 22914..23024 | + | 111 | Protein_32 | transcriptional regulator | - |
| NML27_RS26270 (NML27_26265) | 23099..23338 | - | 240 | WP_094283545.1 | hypothetical protein | - |
| NML27_RS26275 (NML27_26270) | 23328..23585 | - | 258 | WP_024192529.1 | hypothetical protein | - |
| NML27_RS26280 (NML27_26275) | 23622..24164 | - | 543 | WP_094283544.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..24263 | 24263 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13408.35 Da Isoelectric Point: 6.9806
>T251502 WP_094283547.1 NZ_CP101202:22256-22606 [Escherichia coli]
MWNVVTTDIFDAWFLTQNEDLRESVYEAMGLLEKFGPTLGRPYVDTLNGSDFANMKELRVQYKGSPVRAFFAFDPTRNAI
VLCAGDKTGLNEKRFYKDMIKLADSEYRKHLAKLEK
MWNVVTTDIFDAWFLTQNEDLRESVYEAMGLLEKFGPTLGRPYVDTLNGSDFANMKELRVQYKGSPVRAFFAFDPTRNAI
VLCAGDKTGLNEKRFYKDMIKLADSEYRKHLAKLEK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|