Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4883179..4883781 | Replicon | chromosome |
| Accession | NZ_CP101197 | ||
| Organism | Escherichia coli strain EC21Z-151 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | NML27_RS23355 | Protein ID | WP_000897305.1 |
| Coordinates | 4883470..4883781 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NML27_RS23350 | Protein ID | WP_000356395.1 |
| Coordinates | 4883179..4883469 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML27_RS23315 (4878803) | 4878803..4879705 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| NML27_RS23320 (4879702) | 4879702..4880337 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NML27_RS23325 (4880334) | 4880334..4881263 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| NML27_RS23330 (4881445) | 4881445..4881687 | - | 243 | WP_001309881.1 | CopG family transcriptional regulator | - |
| NML27_RS23335 (4881906) | 4881906..4882124 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| NML27_RS23340 (4882543) | 4882543..4882821 | - | 279 | WP_001315112.1 | hypothetical protein | - |
| NML27_RS23345 (4882873) | 4882873..4883094 | - | 222 | WP_001550354.1 | hypothetical protein | - |
| NML27_RS23350 (4883179) | 4883179..4883469 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
| NML27_RS23355 (4883470) | 4883470..4883781 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| NML27_RS23360 (4884010) | 4884010..4884918 | + | 909 | WP_001550353.1 | alpha/beta hydrolase | - |
| NML27_RS23365 (4885086) | 4885086..4886000 | - | 915 | WP_233304549.1 | transposase | - |
| NML27_RS23370 (4886013) | 4886013..4886900 | - | 888 | Protein_4564 | hypothetical protein | - |
| NML27_RS23375 (4887316) | 4887316..4888257 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| NML27_RS23380 (4888302) | 4888302..4888739 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T251492 WP_000897305.1 NZ_CP101197:c4883781-4883470 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|